IKMC Project Report - EUCOMM (ID: 100018)

Adamts18 MGI:2442600 ENSMUSG00000053399
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000093113 protein_coding No protein product (NMD) view

Predicted translation: 

MECALLCLCALRAAGPGPPWGPAGLGRLAKALQLCCFCCASVAVALASDSGSSGGSGLNDDYVFVVPVEVDSGGSYISHD
ILHHRKRRSAHGASNSLHYRVSAFGQDLHLELKPSAILSSHFRVQVLGKDGASETREPEVPQCLYQGFIRNDSSSSVAVS
TCAGLSGLIRTRDNEFLISPLPQLLAQEHNYSSPAGHHPHVLYKRTAEKRVRWYQDYPGSQRTYPGHSPSHTPPASQSQE
PEYSHRRWQKRHFCGRRKK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000634254 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000512154 Peptidase_M12B_N (11/154 aa) CDS CDS
ENSMUSE00000605836 Peptidase_M12B_N (105/154 aa) CDS CDS
ENSMUSE00000516781 Peptidase_M12B_N (39/154 aa) CDS CDS
ENSMUSE00000413798 Peptidase_M12B (29/204 aa) CDS Deleted
ENSMUSE00000304886 Peptidase_M12B (28/204 aa) CDS Deleted
ENSMUSE00000304879 Peptidase_M12B (54/204 aa) CDS CDS + stop codon + UTR
ENSMUSE00000579896 Peptidase_M12B (36/204 aa) CDS
ENSMUSE00000579895 Peptidase_M12B (47/204 aa) CDS
ENSMUSE00000488459 Peptidase_M12B (13/204 aa) CDS
ENSMUSE00000489398 CDS
ENSMUSE00000491038 Thrombospondin_1_rpt (27/51 aa) CDS
ENSMUSE00000492089 Thrombospondin_1_rpt (25/51 aa) CDS
ENSMUSE00000493161 CDS
ENSMUSE00000494195 ADAM_spacer1 (13/112 aa) CDS
ENSMUSE00000496717 ADAM_spacer1 (82/112 aa) CDS
ENSMUSE00000304786 ADAM_spacer1 (18/112 aa) CDS
ENSMUSE00000212805 CDS
ENSMUSE00000212815 Thrombospondin_1_rpt (54/54 aa) | Thrombospondin_1_rpt (4/24 aa) CDS
ENSMUSE00000212806 Thrombospondin_1_rpt (20/24 aa) | Thrombospondin_1_rpt (4/57 aa) CDS
ENSMUSE00000605835 Thrombospondin_1_rpt (53/57 aa) | Thrombospondin_1_rpt (4/48 aa) CDS
ENSMUSE00000605834 Thrombospondin_1_rpt (44/48 aa) CDS
ENSMUSE00000969228 PLAC (33/33 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available