IKMC Project Report - KOMP-CSD (ID: 100224)

Npr3 MGI:97373 ENSMUSG00000022206
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000066529 protein_coding No protein product (NMD) view

Predicted translation: 

MRSLLLFTFSACVLLARVLLAGGASSGAGDTRPGSRRRAREALAAQKIEVLVLLPRDDSYLFSLARVRPAIEYALRSVEG
NGTGRKLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQ
HKDTEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSAYNFDETKDLDLD
DIVRYIQGSERVVIMCASGDTIRRIMLAVHRHGMTSGDYAFFNIELFNSSSYGDGSWRRGDKHDSEAKQAYSSLQTVTLL
RTVKPEFEKFSMEVKSSVEKQGLNEEDYVSPGRCP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000373904 ANF_lig-bd_rcpt (185/352 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000493505 ANF_lig-bd_rcpt (42/352 aa) CDS CDS
ENSMUSE00001044061 ANF_lig-bd_rcpt (56/352 aa) CDS CDS
ENSMUSE00000518680 ANF_lig-bd_rcpt (46/352 aa) CDS Deleted
ENSMUSE00000445443 ANF_lig-bd_rcpt (26/352 aa) CDS CDS + stop codon + UTR
ENSMUSE00000124379 CDS
ENSMUSE00000124377 CDS
ENSMUSE00000517157 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 199046 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06019_A_5_E08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199046 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGRS06019_A_E08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199046 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06019_A_8_E08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199046 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06019_A_4_E08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199046 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06019_A_7_E08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199046 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06019_A_6_E08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199046 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06019_A_3_E08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199046 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06019_A_1_E08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
199046 Knockout First, Reporter-tagged insertion with conditional potential PCS06019_A_E08