IKMC Project Report - EUCOMM (ID: 101290)
Ptchd4 MGI:1920485 ENSMUSG00000042256
Mice no data available
Mutagenesis Predictions
This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000048691 | protein_coding | Residual N-terminal, novel C-terminal product | view | |||||||||||||||||||||||||||
|
Predicted translation: MRRPGAPASWIWWRMLRQVLRRGLQSFCHRLGLCVSRHPVFFLTVPAVLTITFGLSALNRFQTEGDLERLVAPSHSLAKI ERSLASSLFPLDQSKSQLYSDLHTPGRYGRVILLSSPGDNILLQAEGILQTHRAVMEMKVNHKGYNYTFSHLCVLRNQDK KCVLDDIISVLEDLRQAAVSNKTTARVQVRYPNTKLKVMELKEYLSFCLDGGEPKRIYPSKTG*
|
||||||||||||||||||||||||||||||
ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | HEPD0816_7_F07 | PG00250_Z_2_A03 | Ptchd4tm1a(EUCOMM)Hmgu | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1.C2 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones Without Conditional Potential
Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | HEPD0816_7_D05 | PG00250_Z_2_A03 | Ptchd4tm1e(EUCOMM)Hmgu | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1.C2 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 375501 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00250_Z_2_G01 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 375501 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00250_Z_2_F06 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 375501 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00250_Z_2_A06 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 375501 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00250_Z_2_A03 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 375501 | Knockout First, Reporter-tagged insertion with conditional potential | PCS00250_A_B01 |