IKMC Project Report - EUCOMM (ID: 101516)

Mvk MGI:107624 ENSMUSG00000041939 OTTMUSG00000014479
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000043760 protein_coding No protein product (NMD) view

Predicted translation:

MLSEALLVSAPGKVILHGEHAVVHGKVALAAALNLRTFLLLRPQSNGKVSVNLPNIGIKQVWDVGMLQRLDTSFLEQGDV
SVPTLEQLEKLKKMGDLPRDRAGNEGMALLAFLYLYLAICRKQRTLPSLDMVVWSELPPGAGLGSSAAYSVCLAAALLTA
CEEVSNPLKDGVSVSRRSPALPARDDVFLEEPPVSADPAHQHQGPAEYQGPCGCCQKQADQVP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000817443 UTR UTR
ENSMUSE00001015217 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000975596 CDS CDS
ENSMUSE00001044374 CDS CDS
ENSMUSE00001027007 GHMP_kinase_N_dom (45/82 aa) CDS CDS
ENSMUSE00001075354 GHMP_kinase_N_dom (36/82 aa) CDS Deleted
ENSMUSE00001083073 GHMP_kinase_N_dom (3/82 aa) CDS CDS
ENSMUSE00001084324 CDS CDS
ENSMUSE00001018328 CDS CDS + stop codon + UTR
ENSMUSE00000967484 GHMP_kinase_C_dom (52/62 aa) CDS
ENSMUSE00000782838 GHMP_kinase_C_dom (11/62 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112239 protein_coding No protein product (NMD) view

Predicted translation:

MLSEALLVSAPGKVILHGEHAVVHGKVALAAALNLRTFLLLRPQSNGKVSVNLPNIGIKQVWDVGMLQRLDTSFLGLSPT
CLFARVTEQGDVSVPTLEQLEKLKKMGDLPRDRAGNEGMALLAFLYLYLAICRKQRTLPSLDMVVWSELPPGAGLGSSAA
YSVCLAAALLTACEEVSNPLKDGVSVSRRSPALPARDDVFLEEPPVSADPAHQHQGPAEYQGPCGCCQKQADQVP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000815973 UTR UTR
ENSMUSE00001015217 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000975596 CDS CDS
ENSMUSE00001066585 CDS CDS
ENSMUSE00001027007 GHMP_kinase_N_dom (45/82 aa) CDS CDS
ENSMUSE00001075354 GHMP_kinase_N_dom (36/82 aa) CDS Deleted
ENSMUSE00001083073 GHMP_kinase_N_dom (3/82 aa) CDS CDS
ENSMUSE00001084324 CDS CDS
ENSMUSE00001018328 CDS CDS + stop codon + UTR
ENSMUSE00000967484 GHMP_kinase_C_dom (52/62 aa) CDS
ENSMUSE00000800039 GHMP_kinase_C_dom (11/62 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000125650 protein_coding No analysis available: incomplete transcript
ENSMUST00000125120 retained_intron No analysis available: incomplete transcript
ENSMUST00000137167 retained_intron No analysis available: incomplete transcript
ENSMUST00000124260 retained_intron No analysis available: incomplete transcript
ENSMUST00000139420 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available