IKMC Project Report - EUCOMM (ID: 102622)

L3mbtl3 MGI:2143628 ENSMUSG00000039089 OTTMUSG00000037127
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000040219 protein_coding No protein product (NMD) view

Predicted translation: 

MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDESEMESVKKATATTTWMVPTAQDAPTSPPSSR
PVFPPAYWTSPPGCPTEIKRMNGMEAKTTMRKILSVVERKSQNCL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000908165 UTR UTR
ENSMUSE00000368432 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000407781 CDS CDS
ENSMUSE00000430822 CDS CDS
ENSMUSE00000309524 CDS Deleted
ENSMUSE00000309519 CDS CDS + stop codon + UTR
ENSMUSE00000309513 CDS
ENSMUSE00000309507 CDS
ENSMUSE00000309502 Mbt (20/73 aa) CDS
ENSMUSE00000309643 Mbt (46/73 aa) CDS
ENSMUSE00000309496 Mbt (8/73 aa) CDS
ENSMUSE00000309489 Mbt (40/70 aa) CDS
ENSMUSE00000430788 Mbt (27/70 aa) CDS
ENSMUSE00000430783 Mbt (5/70 aa) CDS
ENSMUSE00001055809 Mbt (27/66 aa) CDS
ENSMUSE00000430773 Mbt (39/66 aa) CDS
ENSMUSE00000430769 Mbt (1/66 aa) CDS
ENSMUSE00000430767 CDS
ENSMUSE00000347064 CDS
ENSMUSE00000430759 SAM_type1 (6/65 aa) | SAM_2 (6/62 aa) CDS
ENSMUSE00000430755 SAM_type1 (21/65 aa) | SAM_2 (21/62 aa) CDS
ENSMUSE00000615264 SAM_type1 (38/65 aa) | SAM_2 (35/62 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000174766 protein_coding No protein product (NMD) view

Predicted translation: 

MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDESEMESVKKATATTTWMVPTAQDAPTSPPSSR
PVFPPAYWTSPPGCPTEIKRMNGMEAKTTMRKILSVVERKSQNCL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000933418 UTR UTR
ENSMUSE00000368432 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000407781 CDS CDS
ENSMUSE00000430822 CDS CDS
ENSMUSE00000309524 CDS Deleted
ENSMUSE00000309519 CDS CDS + stop codon + UTR
ENSMUSE00000309513 CDS
ENSMUSE00000309507 CDS
ENSMUSE00000309502 Mbt (20/73 aa) CDS
ENSMUSE00000309643 Mbt (46/73 aa) CDS
ENSMUSE00000309496 Mbt (8/73 aa) CDS
ENSMUSE00000309489 Mbt (40/70 aa) CDS
ENSMUSE00000430788 Mbt (27/70 aa) CDS
ENSMUSE00000430783 Mbt (5/70 aa) CDS
ENSMUSE00001055809 Mbt (27/66 aa) CDS
ENSMUSE00000430773 Mbt (39/66 aa) CDS
ENSMUSE00000430769 Mbt (1/66 aa) CDS
ENSMUSE00000430767 CDS
ENSMUSE00000347064 CDS
ENSMUSE00000430759 SAM_type1 (6/65 aa) | SAM_2 (6/62 aa) CDS
ENSMUSE00000430755 SAM_type1 (21/65 aa) | SAM_2 (21/62 aa) CDS
ENSMUSE00000932978 SAM_type1 (38/65 aa) | SAM_2 (35/62 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000105519 protein_coding No protein product (NMD) view

Predicted translation: 

MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDESEMESVKKATATTTWMVPTAQDEIKRMNGME
AKTTMRKILSVVERKSQNCL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000908165 UTR UTR
ENSMUSE00000368432 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000407781 CDS CDS
ENSMUSE00000309524 CDS Deleted
ENSMUSE00000309519 CDS CDS + stop codon + UTR
ENSMUSE00000309513 CDS
ENSMUSE00000309507 CDS
ENSMUSE00000309502 Mbt (20/73 aa) CDS
ENSMUSE00000309643 Mbt (46/73 aa) CDS
ENSMUSE00000309496 Mbt (8/73 aa) CDS
ENSMUSE00000309489 Mbt (40/70 aa) CDS
ENSMUSE00000430788 Mbt (27/70 aa) CDS
ENSMUSE00000430783 Mbt (5/70 aa) CDS
ENSMUSE00001055809 Mbt (27/66 aa) CDS
ENSMUSE00000430773 Mbt (39/66 aa) CDS
ENSMUSE00000430769 Mbt (1/66 aa) CDS
ENSMUSE00000430767 CDS
ENSMUSE00000347064 CDS
ENSMUSE00000430759 SAM_type1 (6/65 aa) | SAM_2 (6/62 aa) CDS
ENSMUSE00000430755 SAM_type1 (21/65 aa) | SAM_2 (21/62 aa) CDS
ENSMUSE00000945233 SAM_type1 (38/65 aa) | SAM_2 (35/62 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0819_6_D09 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_B09 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_E09 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_G09 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_E12 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_F11 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_D12 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_F10 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_H12 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_D11 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_H09 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_E11 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_F12 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_G12 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_G10 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0819_6_G11 PG00259_Z_7_A04 L3mbtl3tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0819_6_F09 PG00259_Z_7_A04 L3mbtl3tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_A04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_A01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_E04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_A06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_D01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_E06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_E01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_E05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Y_7_F04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_C10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_G10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_D03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_A05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_G11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_H01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_D06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_C11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 401727 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00259_Z_7_H03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors no data available