IKMC Project Report - KOMP-CSD (ID: 102784)

Etl4 MGI:95454 ENSMUSG00000036617 OTTMUSG00000011450
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 20 wild type transcripts, of which 11 are protein-coding. Following removal of the floxed region, 11 transcripts are predicted to produce a truncated protein product of which 6 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000045555 protein_coding No protein product (NMD) view

Predicted translation: 

MEESEGQKCEPNLPPSGDSRQMPQQGRSNLHVTSQEDAACRRPRERLSNGNARAQVSKPARNIPRRHTLGGPRSSKEILG
MQPSEMDRKREAFLEHLKQKYPHHATAIMGHQERLRDQTKSPKLSHSPQPPNLGDPVEHLSETSGDSLEAMSEGEVPSPF
ARGSRTRASLPVVRSANQTKERSLGVLYLQYGDETKQLRMPNEVTSTDTIRALFVSAFPQQLTMKMLESPSVAIYIKDDS
RNVYYELNDVRNIQDRSLLKVYNKDPSHAFNHMTKAVNGDMRMQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVP
HSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYH
EGRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGD
LRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPKDRETS
EKMVKATANRNQADGAAAEPGDSEGDDEEG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000410886 UTR UTR
ENSMUSE00000981826 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001082878 CDS CDS
ENSMUSE00000974882 CDS CDS
ENSMUSE00001020605 AIP3_C (63/81 aa) CDS CDS
ENSMUSE00001053160 AIP3_C (19/81 aa) CDS CDS
ENSMUSE00001023860 CDS CDS
ENSMUSE00001080522 CDS CDS
ENSMUSE00000974684 AIP3_C (34/111 aa) CDS Deleted
ENSMUSE00001033846 AIP3_C (59/111 aa) CDS CDS + stop codon + UTR
ENSMUSE00001057193 AIP3_C (19/111 aa) CDS
ENSMUSE00000993961 CDS
ENSMUSE00001011600 CDS
ENSMUSE00000991329 CDS
ENSMUSE00001001182 CDS
ENSMUSE00001092136 CDS
ENSMUSE00000521501 CDS
ENSMUSE00000983102 CDS
ENSMUSE00001029722 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114604 protein_coding No analysis available: incomplete transcript
ENSMUST00000114614 protein_coding No protein product (NMD) view

Predicted translation: 

MEESEGQKCEPNLPPSGDSRQMPQQGRSNLHVTSQEDAACRRPRERLSNGNARAQVSKPARNIPRRHTLGGPRSSKEILG
MQPSEMDRKREAFLEHLKQKYPHHATAIMGHQERLRDQTKSPKLSHSPQPPNLGDPVEHLSETSGDSLEAMSEGEVPSPF
ARGSRTRASLPVVRSANQTKERSLGVLYLQYGDETKQLRMPNEVTSTDTIRALFVSAFPQQLTMKMLESPSVAIYIKDDS
RNVYYELNDVRNIQDRSLLKVYNKDPSHAFNHMTKAVNGDMRMQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVP
HSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYH
EGRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGD
LRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPKDRETS
EKMVKATANRNQADGAAAEPGDSEGDDEEG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000410886 UTR UTR
ENSMUSE00000981826 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001082878 CDS CDS
ENSMUSE00000974882 CDS CDS
ENSMUSE00001020605 AIP3_C (63/81 aa) CDS CDS
ENSMUSE00001053160 AIP3_C (19/81 aa) CDS CDS
ENSMUSE00001023860 CDS CDS
ENSMUSE00001080522 CDS CDS
ENSMUSE00000974684 AIP3_C (34/111 aa) CDS Deleted
ENSMUSE00001033846 AIP3_C (59/111 aa) CDS CDS + stop codon + UTR
ENSMUSE00001057193 AIP3_C (19/111 aa) CDS
ENSMUSE00000993961 CDS
ENSMUSE00000699944 CDS
ENSMUSE00000991329 CDS
ENSMUSE00001001182 CDS
ENSMUSE00001092136 CDS
ENSMUSE00000521501 CDS
ENSMUSE00000983102 CDS
ENSMUSE00001029722 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114627 protein_coding No protein product (NMD) view

Predicted translation: 

MSLCPPPCCLLRSFFTNAAAKLPSSKKDDLSSKQKKTSRGDKTERIGSEGNLTEYQQVQAAATSAQRKAAAAHKEQGRSN
LHVTSQEDAACRRPRERLSNGNARAQVSKPARNIPRRHTLGGPRSSKEILGMQPSEMDRKREAFLEHLKQKYPHHATAIM
GHQERLRDQTKSPKLSHSPQPPNLGDPVEHLSETSGDSLEAMSEGEVPSPFARGSRTRASLPVVRSANQTKERSLGVLYL
QYGDETKQLRMPNEVTSTDTIRALFVSAFPQQLTMKMLESPSVAIYIKDDSRNVYYELNDVRNIQDRSLLKVYNKDPSHA
FNHMTKAVNGDMRMQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRD
RLSSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHVIAYHRTAI
RSASAYCSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQPDRASPSRQ
SFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPKDRETRERMQAMEKQIASLTGLVQSALFKGPITSS
SKEASSEKMVKATANRNQADGAAAEPGDSEGDDEEG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000699998 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000699995 CDS CDS
ENSMUSE00001082878 CDS CDS
ENSMUSE00000974882 CDS CDS
ENSMUSE00001020605 AIP3_C (63/81 aa) CDS CDS
ENSMUSE00001053160 AIP3_C (19/81 aa) CDS CDS
ENSMUSE00001023860 CDS CDS
ENSMUSE00000647335 CDS CDS
ENSMUSE00001080522 AIP3_C (10/142 aa) CDS CDS
ENSMUSE00000974684 AIP3_C (56/142 aa) CDS Deleted
ENSMUSE00001033846 AIP3_C (59/142 aa) CDS CDS + stop codon + UTR
ENSMUSE00001057193 AIP3_C (19/142 aa) CDS
ENSMUSE00000993961 CDS
ENSMUSE00001011600 CDS
ENSMUSE00000991329 CDS
ENSMUSE00001001182 CDS
ENSMUSE00001092136 CDS
ENSMUSE00000521501 CDS
ENSMUSE00000647331 CDS
ENSMUSE00000647330 CDS
ENSMUSE00000983102 CDS
ENSMUSE00000699974 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000066509 protein_coding No analysis available: incomplete transcript
ENSMUST00000114608 protein_coding No protein product (NMD) view

Predicted translation: 

MQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISP
SPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQA
EMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIE
KPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPKDRETSEKMVKATANRNQADGAAAEPGDSEGDDEEG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000699929 UTR UTR
ENSMUSE00001074153 UTR + start codon + CDS CDS
ENSMUSE00001080522 CDS CDS
ENSMUSE00000974684 CDS Deleted
ENSMUSE00001033846 CDS CDS + stop codon + UTR
ENSMUSE00001057193 CDS
ENSMUSE00000993961 CDS
ENSMUSE00001011600 CDS
ENSMUSE00000991329 CDS
ENSMUSE00001001182 CDS
ENSMUSE00001092136 CDS
ENSMUSE00000521501 CDS
ENSMUSE00000647331 CDS
ENSMUSE00000647330 CDS
ENSMUSE00000983102 CDS
ENSMUSE00000699928 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114607 protein_coding No protein product (NMD) view

Predicted translation: 

MQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISP
SPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQA
EMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIE
KPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPKDRETSEKMVKATANRNQADGAAAEPGDSEGDDEEG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000699927 UTR UTR
ENSMUSE00001074153 UTR + start codon + CDS CDS
ENSMUSE00001080522 CDS CDS
ENSMUSE00000974684 CDS Deleted
ENSMUSE00001033846 CDS CDS + stop codon + UTR
ENSMUSE00001057193 CDS
ENSMUSE00000993961 CDS
ENSMUSE00001011600 CDS
ENSMUSE00000991329 CDS
ENSMUSE00001001182 CDS
ENSMUSE00001092136 CDS
ENSMUSE00000521501 CDS
ENSMUSE00000647331 CDS
ENSMUSE00000699926 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114606 protein_coding No protein product (NMD) view

Predicted translation: 

MQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISP
SPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQA
EMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIE
KPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPKDRETSEKMVKATANRNQADGAAAEPGDSEGDDEEG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000699929 UTR UTR
ENSMUSE00001074153 UTR + start codon + CDS CDS
ENSMUSE00001080522 CDS CDS
ENSMUSE00000974684 CDS Deleted
ENSMUSE00001033846 CDS CDS + stop codon + UTR
ENSMUSE00001057193 CDS
ENSMUSE00000993961 CDS
ENSMUSE00001011600 CDS
ENSMUSE00000991329 CDS
ENSMUSE00001001182 CDS
ENSMUSE00001092136 CDS
ENSMUSE00000521501 CDS
ENSMUSE00000699925 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114610 protein_coding Target region does not overlap transcript
ENSMUST00000146881 protein_coding Target region does not overlap transcript
ENSMUST00000131714 protein_coding Target region does not overlap transcript
ENSMUST00000125772 retained_intron No analysis available: incomplete transcript
ENSMUST00000146613 retained_intron Target region does not overlap transcript
ENSMUST00000146488 retained_intron No analysis available: incomplete transcript
ENSMUST00000156587 retained_intron Target region does not overlap transcript
ENSMUST00000136870 processed_transcript Target region does not overlap transcript
ENSMUST00000125556 processed_transcript Target region does not overlap transcript
ENSMUST00000123383 processed_transcript Target region does not overlap transcript
ENSMUST00000129278 processed_transcript Target region does not overlap transcript
ENSMUST00000139531 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0816_2_F12 PRPGS00221_A_H08 Etl4tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0816_2_F11 PRPGS00221_A_H08 Etl4tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0816_2_C12 PRPGS00221_A_H08 Etl4tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0816_2_D11 PRPGS00221_A_H08 Etl4tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0816_2_F10 PRPGS00221_A_H08 Etl4tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0816_2_D09 PRPGS00221_A_H08 Etl4tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 281609 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00221_A_H08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 281609 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00221_Z_1_H08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
281609 Knockout-First - Reporter Tagged Insertion PCTS00221_A_H08