IKMC Project Report - EUCOMM (ID: 102929)

1110017D15Rik MGI:1920971 ENSMUSG00000028441 OTTMUSG00000006656
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation in Progress

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000030152 protein_coding No protein product (NMD) view

Predicted translation: 

MFLFSRKTKTPISTYSDSYRAPTSIKEVYKDPPLWAWEANKFVTPRTNAVRATWTMTGTTRGRRVLAATTGTSIPAVFLD
CPRTPGWSQFEECRWNILLSRSASTPTSAR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000675377 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000982167 CDS Deleted
ENSMUSE00001042921 CDS CDS
ENSMUSE00001031042 CDS CDS
ENSMUSE00001042812 CDS CDS + stop codon + UTR
ENSMUSE00001094683 CDS + stop codon + UTR
ENSMUSE00001052487 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000095126 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MFLFSRKTKTPISTYSDSYRAPTSIKEVYKDPPLWAWEANKFVTPRTNAVRATWTMTGTTRGRRVLAATTGTSIPAVFLD
CPRTPGWSQFEECRWNILLSRSASTPTECVALRSPARNAMCCYNSPAIILPVSQP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000675377 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000982167 CDS Deleted
ENSMUSE00001042921 CDS CDS
ENSMUSE00001031042 CDS CDS
ENSMUSE00000972033 CDS CDS
ENSMUSE00001060909 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000125303 protein_coding No analysis available: incomplete transcript
ENSMUST00000134546 processed_transcript No analysis available: incomplete transcript
ENSMUST00000124019 processed_transcript Target region does not overlap transcript
ENSMUST00000123356 processed_transcript Target region does not overlap transcript
ENSMUST00000123865 processed_transcript Target region does not overlap transcript
ENSMUST00000138217 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0796_5_E10 PG00256_Z_7_B08 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1.C2 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0796_5_D11 PG00256_Z_7_B08 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1.C2 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 385662 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00256_Z_7_B08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 385662 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00256_Z_7_B10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 385662 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00256_Z_7_A05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
385662 Knockout-First - Reporter Tagged Insertion PCS00256_A_G06