IKMC Project Report - KOMP-CSD (ID: 103137)

Fasn MGI:95485 ENSMUSG00000025153 OTTMUSG00000004143
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000055655 protein_coding No protein product (NMD) view

Predicted translation: 

MEEVVIAGMSGKLPESENLQEFWANLIGGVDMVTDDDRRWKAGLYGLPKRSGKLKDLSKFDASFFGVHPKQAHTMDPQLR
LLLEVSYEAIVDGGAVIPGAWGLGP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000148353 UTR UTR
ENSMUSE00000574924 Ketoacyl_synth_N (42/238 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000499065 Ketoacyl_synth_N (52/238 aa) CDS CDS
ENSMUSE00000507251 Ketoacyl_synth_N (59/238 aa) CDS Deleted
ENSMUSE00000504402 Ketoacyl_synth_N (68/238 aa) CDS Deleted
ENSMUSE00000505357 Ketoacyl_synth_N (21/238 aa) | Ketoacyl_synth_C (17/118 aa) CDS Deleted
ENSMUSE00000502631 Ketoacyl_synth_C (39/118 aa) CDS Deleted
ENSMUSE00000466870 Ketoacyl_synth_C (45/118 aa) CDS Deleted
ENSMUSE00000472293 Acyl_transferase (5/318 aa) | Ketoacyl_synth_C (18/118 aa) CDS CDS + stop codon + UTR
ENSMUSE00000473209 Acyl_transferase (63/318 aa) CDS
ENSMUSE00000470489 Acyl_transferase (64/318 aa) CDS
ENSMUSE00000471401 Acyl_transferase (32/318 aa) CDS
ENSMUSE00000520112 Acyl_transferase (45/318 aa) CDS
ENSMUSE00000464142 Acyl_transferase (68/318 aa) CDS
ENSMUSE00000462300 Acyl_transferase (39/318 aa) CDS
ENSMUSE00000463211 Acyl_transferase (5/318 aa) CDS
ENSMUSE00000486694 CDS
ENSMUSE00000483852 CDS
ENSMUSE00000489052 CDS
ENSMUSE00000490240 CDS
ENSMUSE00000487209 CDS
ENSMUSE00000485543 CDS
ENSMUSE00000478476 Methyltransf_12 (99/99 aa) CDS
ENSMUSE00000475601 CDS
ENSMUSE00000476706 CDS
ENSMUSE00000473829 CDS
ENSMUSE00000482953 CDS
ENSMUSE00000478312 CDS
ENSMUSE00000498341 ADH_C (21/122 aa) CDS
ENSMUSE00000148348 ADH_C (41/122 aa) CDS
ENSMUSE00000148327 ADH_C (42/122 aa) CDS
ENSMUSE00000364562 ADH_C (21/122 aa) CDS
ENSMUSE00000409856 PKS_KR (37/180 aa) | DH_sc/Rdtase_SDR (38/169 aa) CDS
ENSMUSE00000148346 PKS_KR (51/180 aa) | DH_sc/Rdtase_SDR (51/169 aa) CDS
ENSMUSE00000148322 PKS_KR (31/180 aa) | DH_sc/Rdtase_SDR (31/169 aa) CDS
ENSMUSE00000148338 PKS_KR (52/180 aa) | DH_sc/Rdtase_SDR (51/169 aa) CDS
ENSMUSE00000309150 PKS_KR (12/180 aa) | Acyl_carrier_prot-like (10/56 aa) CDS
ENSMUSE00000148320 Acyl_carrier_prot-like (47/56 aa) CDS
ENSMUSE00001084750 Thioesterase (34/260 aa) CDS
ENSMUSE00001039490 Thioesterase (74/260 aa) CDS
ENSMUSE00000148329 Thioesterase (33/260 aa) CDS
ENSMUSE00000148334 Thioesterase (84/260 aa) CDS
ENSMUSE00000414956 Thioesterase (36/260 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000155276 retained_intron Target region does not overlap transcript
ENSMUST00000146541 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 119308 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PSA0002_B_3_B08 pL1L2_GT1_bsd_frt15_neo_barcode R3R4_pBR_amp view
order 119308 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PSA0002_B_2_B08 pL1L2_GT1_bsd_frt15_neo_barcode R3R4_pBR_amp view
order 119308 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PSA0002_B_4_B08 pL1L2_GT1_bsd_frt15_neo_barcode R3R4_pBR_amp view
order 119308 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PSA0002_B_2_B11 pL1L2_GT1_bsd_frt15_neo_barcode R3R4_pBR_amp view
order 119308 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PSA0002_B_3_B11 pL1L2_GT1_bsd_frt15_neo_barcode R3R4_pBR_amp view
order 119308 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PSA0002_B_4_B11 pL1L2_GT1_bsd_frt15_neo_barcode R3R4_pBR_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
119308 Knockout-First - Reporter Tagged Insertion PCP10002_A_B08
119308 Knockout-First - Reporter Tagged Insertion PCP10002_A_B11