IKMC Project Report - EUCOMM (ID: 113725)

Trpc6 MGI:109523 ENSMUSG00000031997
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000050433 protein_coding No protein product (NMD) view

Predicted translation: 

MSQSPRFVTRRGGSLKAAPGAGTRRNESQDYLLMDELGDDGYPQLPLPPYGYYPSFRGNENRLTHRRQTILREKGRRLAN
RGPAYMFNDHSTSLSIEEERFLDAAEYGNIPVVRKMLEECHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRV
GDALLLAISKGYVRIVEAILNHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRK
GARIERPHDYFCKCTECSQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYRKL
SMQCKDFVVGLLDLCRNTEEVEAILNGDAETRQPGDFGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQ
TMAVKFLVVLAVAIGLPFLALIYWCAPCSKA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000400265 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000502783 TRP_dom (62/63 aa) CDS CDS
ENSMUSE00000215577 TRP_dom (1/63 aa) CDS CDS
ENSMUSE00000215575 CDS CDS
ENSMUSE00000215583 Ion_trans_dom (7/231 aa) | PKD1_2_channel (15/246 aa) CDS Deleted
ENSMUSE00000215579 Ion_trans_dom (79/231 aa) | PKD1_2_channel (79/246 aa) CDS CDS + stop codon + UTR
ENSMUSE00000539830 Ion_trans_dom (89/231 aa) | PKD1_2_channel (89/246 aa) CDS
ENSMUSE00000301131 Ion_trans_dom (59/231 aa) | PKD1_2_channel (66/246 aa) CDS
ENSMUSE00000215574 CDS
ENSMUSE00000215573 CDS
ENSMUSE00000215580 CDS
ENSMUSE00000215582 CDS
ENSMUSE00000454306 CDS
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 403293 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00260_Z_2_C03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 403293 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00260_Z_2_C11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 403293 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00260_Z_2_C10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 403293 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00260_Z_2_C04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 403293 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00260_Z_2_F11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 403293 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00260_Z_2_A11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 403293 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00260_Z_2_B01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors no data available