IKMC Project Report - EUCOMM (ID: 113739)

Cftr MGI:88388 ENSMUSG00000041301 OTTMUSG00000024173
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000045706 protein_coding No protein product (NMD) view

Predicted translation: 

MQKSPLEKASFISKLFFSWTTPILRKGYRHHLELSDIYQAPSADSADHLSEKLEREWDREQASKKNPQLIHALRRCFFWR
FLFYGILLYLGEVTKAVQPVLLGRIIASYDPENKVERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHRIGMQMRTAMFSLI
YKKRSESCKDQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000565106 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000565105 CDS CDS
ENSMUSE00000328314 ABC_transptr_TM_dom (9/269 aa) CDS CDS
ENSMUSE00000328308 ABC_transptr_TM_dom (72/269 aa) CDS CDS
ENSMUSE00000328301 ABC_transptr_TM_dom (30/269 aa) CDS Deleted
ENSMUSE00000328293 ABC_transptr_TM_dom (55/269 aa) CDS Deleted
ENSMUSE00000328287 ABC_transptr_TM_dom (43/269 aa) CDS CDS + stop codon + UTR
ENSMUSE00000328280 ABC_transptr_TM_dom (62/269 aa) CDS
ENSMUSE00000328273 CDS
ENSMUSE00000328265 CDS
ENSMUSE00000328255 ABC_transporter-like (63/111 aa) CDS
ENSMUSE00000328250 ABC_transporter-like (32/111 aa) CDS
ENSMUSE00001093595 ABC_transporter-like (17/111 aa) CDS
ENSMUSE00000982171 CDS
ENSMUSE00001049534 ABC_transptr_TM_dom (11/286 aa) CDS
ENSMUSE00001079381 ABC_transptr_TM_dom (13/286 aa) CDS
ENSMUSE00001001443 ABC_transptr_TM_dom (85/286 aa) CDS
ENSMUSE00001002261 ABC_transptr_TM_dom (27/286 aa) CDS
ENSMUSE00001031771 ABC_transptr_TM_dom (51/286 aa) CDS
ENSMUSE00001042203 ABC_transptr_TM_dom (77/286 aa) CDS
ENSMUSE00001042181 ABC_transptr_TM_dom (26/286 aa) CDS
ENSMUSE00000993519 CDS
ENSMUSE00001043848 ABC_transporter-like (40/123 aa) CDS
ENSMUSE00001041574 ABC_transporter-like (30/123 aa) CDS
ENSMUSE00001045322 ABC_transporter-like (53/123 aa) CDS
ENSMUSE00001026136 CDS
ENSMUSE00000798991 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000115406 protein_coding No protein product (NMD) view

Predicted translation: 

MQKSPLEKASFISKLFFSWTTPILRKGYRHHLELSDIYQAPSADSADHLSEKLEREWDREQASKKNPQLIHALRRCFFWR
FLFYGILLYLGEVTKAVQPVLLGRIIASYDPENKVERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHRIGMQMRTAMFSLI
YKKRSESCKDQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000702762 CDS CDS
ENSMUSE00000565105 CDS CDS
ENSMUSE00000328314 ABC_transptr_TM_dom (9/84 aa) CDS CDS
ENSMUSE00000328308 ABC_transptr_TM_dom (72/84 aa) CDS CDS
ENSMUSE00000328293 ABC_transptr_TM_dom (3/84 aa) | ABC_transptr_TM_dom (55/158 aa) CDS Deleted
ENSMUSE00000328287 ABC_transptr_TM_dom (43/158 aa) CDS CDS + stop codon + UTR
ENSMUSE00000328280 ABC_transptr_TM_dom (62/158 aa) CDS
ENSMUSE00000328273 CDS
ENSMUSE00000328265 CDS
ENSMUSE00000328255 ABC_transporter-like (63/111 aa) CDS
ENSMUSE00000328250 ABC_transporter-like (32/111 aa) CDS
ENSMUSE00001093595 ABC_transporter-like (17/111 aa) CDS
ENSMUSE00000982171 CDS
ENSMUSE00001049534 ABC_transptr_TM_dom (11/286 aa) CDS
ENSMUSE00001079381 ABC_transptr_TM_dom (13/286 aa) CDS
ENSMUSE00001001443 ABC_transptr_TM_dom (85/286 aa) CDS
ENSMUSE00001002261 ABC_transptr_TM_dom (27/286 aa) CDS
ENSMUSE00001031771 ABC_transptr_TM_dom (51/286 aa) CDS
ENSMUSE00001042203 ABC_transptr_TM_dom (77/286 aa) CDS
ENSMUSE00001042181 ABC_transptr_TM_dom (26/286 aa) CDS
ENSMUSE00000993519 CDS
ENSMUSE00001043848 ABC_transporter-like (40/123 aa) CDS
ENSMUSE00001041574 ABC_transporter-like (30/123 aa) CDS
ENSMUSE00001045322 ABC_transporter-like (53/123 aa) CDS
ENSMUSE00001026136 CDS
ENSMUSE00000702761 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000129452 protein_coding No analysis available: incomplete transcript
ENSMUST00000115405 nonsense_mediated_decay No protein product (NMD) view

Predicted translation: 

MQKSPLEKASFISKLFFSWTTPILRKGYRHHLELSDIYQAPSADSADHLSEKLEREWDREQASKKNPQLIHALRRCFFWR
FLFYGILLYLGEVTKAVQPVLLGRIIASYDPENKVERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHRIGMQMRTAMFSLI
YKKRSESCKDQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000565106 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000565105 CDS CDS
ENSMUSE00000328314 ABC_transptr_TM_dom (9/269 aa) CDS CDS
ENSMUSE00000328308 ABC_transptr_TM_dom (72/269 aa) CDS CDS
ENSMUSE00000328301 ABC_transptr_TM_dom (30/269 aa) CDS Deleted
ENSMUSE00000328293 ABC_transptr_TM_dom (55/269 aa) CDS Deleted
ENSMUSE00000328287 ABC_transptr_TM_dom (43/269 aa) CDS CDS + stop codon + UTR
ENSMUSE00000328280 ABC_transptr_TM_dom (62/269 aa) CDS
ENSMUSE00000328273 CDS
ENSMUSE00000328265 CDS
ENSMUSE00000328255 ABC_transporter-like (63/101 aa) CDS
ENSMUSE00000328250 ABC_transporter-like (32/101 aa) CDS
ENSMUSE00000981441 ABC_transporter-like (7/101 aa) CDS
ENSMUSE00001078744 CDS + stop codon + UTR
ENSMUSE00001043515 UTR UTR
ENSMUSE00000992555 UTR UTR
ENSMUSE00001090420 UTR UTR
ENSMUSE00001026295 UTR UTR
ENSMUSE00001037383 UTR UTR
ENSMUSE00001088557 UTR UTR
ENSMUSE00000969136 UTR UTR
ENSMUSE00001041694 UTR UTR
ENSMUSE00000967607 UTR UTR
ENSMUSE00001053579 UTR UTR
ENSMUSE00000974422 UTR UTR
ENSMUSE00001093254 UTR UTR
ENSMUSE00001058905 UTR UTR
ENSMUSE00000777864 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000140407 nonsense_mediated_decay No protein product (NMD) view

Predicted translation: 

MQKSPLEKASFISKLFFSWTTPILRKGYRHHLELSDIYQAPSADSADHLSEKLEREWDREQASKKNPQLIHALRRCFFWR
FLFYGILLYLGEVTKAVQPVLLGRIIASYDPENKVERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHRIGMQMRTAMFSLI
YKKRSESCKDQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000565106 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000565105 CDS CDS
ENSMUSE00000328314 ABC_transptr_TM_dom (9/269 aa) CDS CDS
ENSMUSE00000328308 ABC_transptr_TM_dom (72/269 aa) CDS CDS
ENSMUSE00000328301 ABC_transptr_TM_dom (30/269 aa) CDS Deleted
ENSMUSE00000328293 ABC_transptr_TM_dom (55/269 aa) CDS Deleted
ENSMUSE00000328287 ABC_transptr_TM_dom (43/269 aa) CDS CDS + stop codon + UTR
ENSMUSE00000328280 ABC_transptr_TM_dom (62/269 aa) CDS
ENSMUSE00000328273 CDS
ENSMUSE00000328265 CDS
ENSMUSE00000328255 ABC_transporter-like (63/100 aa) CDS
ENSMUSE00000328250 ABC_transporter-like (32/100 aa) CDS
ENSMUSE00000830687 ABC_transporter-like (6/100 aa) CDS + stop codon + UTR
ENSMUSE00001018813 UTR UTR
ENSMUSE00001043515 UTR UTR
ENSMUSE00000992555 UTR UTR
ENSMUSE00001090420 UTR UTR
ENSMUSE00001026295 UTR UTR
ENSMUSE00001037383 UTR UTR
ENSMUSE00001088557 UTR UTR
ENSMUSE00000969136 UTR UTR
ENSMUSE00001041694 UTR UTR
ENSMUSE00000967607 UTR UTR
ENSMUSE00001053579 UTR UTR
ENSMUSE00000974422 UTR UTR
ENSMUSE00001093254 UTR UTR
ENSMUSE00001058905 UTR UTR
ENSMUSE00000777864 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000140532 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0822_1_C08 PG00261_Z_6_F04 Cftrtm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0822_1_A06 PG00261_Z_6_F04 Cftrtm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0822_1_C06 PG00261_Z_6_F04 Cftrtm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0822_1_G08 PG00261_Z_6_F04 Cftrtm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0822_1_H08 PG00261_Z_6_F04 Cftrtm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0822_1_D06 PG00261_Z_6_F04 Cftrtm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0822_1_B05 PG00261_Z_6_F04 Cftrtm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0822_1_B07 PG00261_Z_6_F04 Cftrtm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0822_1_E07 PG00261_Z_6_F04 Cftrtm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0822_1_F08 PG00261_Z_6_F04 Cftrtm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0822_1_H05 PG00261_Z_6_F04 Cftrtm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0822_1_B08 PG00261_Z_6_F04 Cftrtm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0822_1_H06 PG00261_Z_6_F04 Cftrtm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 403339 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00261_Z_6_H09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 403339 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00261_Z_6_E10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 403339 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00261_Z_6_F04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors no data available