IKMC Project Report - EUCOMM (ID: 114056)

2310009B15Rik MGI:1916799 ENSMUSG00000079283
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000112025 protein_coding Residual C-terminal product view

Predicted translation:

MDPATGYVVLTRLAHLQRGACCGSACRHCPYGQVNVKDPSKKKQFNSYFYV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000690173 UTR + start codon + CDS UTR
ENSMUSE00000690173 CDS Deleted
ENSMUSE00000690172 CDS UTR + start codon + CDS
ENSMUSE00000690171 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available