IKMC Project Report - EUCOMM (ID: 114066)

1600015I10Rik MGI:1917011 ENSMUSG00000029813 OTTMUSG00000037958
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000031837 protein_coding No protein product (NMD) view

Predicted translation:

MLCSRAMGMAQKSLTLGWVTAILLLQMAIADRPRWSLNGRHQEQIPDTADHSEKHHQL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000940505 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000940505 Cu_amine_oxidase_C (222/400 aa) | Cu_amine_oxidase_N2 (81/81 aa) | Cu_amine_oxidase_N3 (100/100 aa) CDS Deleted
ENSMUSE00000193022 Cu_amine_oxidase_C (97/400 aa) CDS CDS + stop codon + UTR
ENSMUSE00001044080 Cu_amine_oxidase_C (45/400 aa) CDS
ENSMUSE00000937169 Cu_amine_oxidase_C (38/400 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available