IKMC Project Report - EUCOMM (ID: 114135)

1700003F12Rik MGI:1922730 ENSMUSG00000038523 OTTMUSG00000015791
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000045116 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MGNSSSHKRTKAPNQANKDRPPDMDKARHKQFFSHLKRKKPS

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000327737 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000327732 CDS Deleted
ENSMUSE00000327725 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000109709 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MGNSSSHKRTKAPNQANKDRPPDMDKARHKQFFSHLKRKKPS

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000800796 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000681284 CDS Deleted
ENSMUSE00000327725 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000135641 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 440204 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00276_Y_4_A08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 440204 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00276_Y_4_B01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 440204 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00276_Y_B01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 440204 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04038_Z_6_A03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 440204 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04038_Z_6_D01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 440204 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04038_Y_6_F04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 440204 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00276_Y_A08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 440204 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00276_Z_4_B01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 440204 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04038_Y_6_D09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
440204 Knockout-First - Reporter Tagged Insertion PCS04038_A_F01