IKMC Project Report - EUCOMM (ID: 114373)
U2af1l4 MGI:2678374 ENSMUSG00000078765 OTTMUSG00000036722
Mice no data available
Mutagenesis Predictions
This gene has 38 wild type transcripts, of which 9 are protein-coding. Following removal of the floxed region, 9 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000043273 | protein_coding | Residual N-terminal, unknown C-terminal | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQ
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000163464 | protein_coding | Residual N-terminal, unknown C-terminal | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQ
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000166510 | protein_coding | Residual N-terminal, unknown C-terminal | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQ
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000163330 | protein_coding | Design floxes first exon in transcript ENSMUST00000163330 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000163654 | protein_coding | Residual N-terminal, unknown C-terminal | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQ
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000171850 | protein_coding | Residual N-terminal, unknown C-terminal | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQ
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000166257 | protein_coding | Residual N-terminal, unknown C-terminal | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQ
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000168931 | protein_coding | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000163482 | protein_coding | No protein product | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000167042 | nonsense_mediated_decay | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQITSSRKTAGSMTSAIL*
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000171912 | nonsense_mediated_decay | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQITSSRKTAGSMTSAIL*
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000108161 | nonsense_mediated_decay | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQITSSRKTAGSMTSAIL*
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000168333 | nonsense_mediated_decay | Residual N-terminal, unknown C-terminal | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQ
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000168229 | nonsense_mediated_decay | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000168555 | nonsense_mediated_decay | Residual N-terminal, unknown C-terminal | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MAEYLASIFGTEKDKLEPAGTGTGAPDFTTNRLSA
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000167501 | nonsense_mediated_decay | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000163276 | nonsense_mediated_decay | Residual N-terminal, unknown C-terminal | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MAEYLASIFGTEKDKLEPAGTGTGAPDFTTNRLSA
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000163848 | nonsense_mediated_decay | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000165722 | nonsense_mediated_decay | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000164365 | nonsense_mediated_decay | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000165773 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000167361 | processed_transcript | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000166960 | processed_transcript | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000169283 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000168222 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000169911 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000164438 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000169071 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000165009 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000165524 | processed_transcript | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000169962 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000167024 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000165543 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000170453 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000167202 | processed_transcript | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000163994 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000166864 | processed_transcript | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000171364 | processed_transcript | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones no data available
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_Y_3_E03 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_Y_3_C11 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_Y_3_G04 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_Y_3_B07 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_U_3_G07 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_W_2_G01 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_Y_3_D11 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_U_3_G08 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_Y_3_G07 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_U_3_D01 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_Y_3_D01 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_W_3_F04 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_Y_3_G08 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_W_3_E12 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_Y_3_H01 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_U_3_H01 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_U_3_D11 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_U_3_C11 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_U_3_G01 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_U_3_B07 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_W_3_H07 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_U_3_G04 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_U_3_E03 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_Y_3_G01 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |
| order | 446638 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00284_W_3_H09 | L1L2_GT0_LF2A_LacZ_BetactP_neo | L3L4_pD223_DTA_T_spec | view |