IKMC Project Report - EUCOMM (ID: 114387)

Taar4 MGI:2685072 ENSMUSG00000069707 OTTMUSG00000019215
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000092660 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MNTPDPWSSPEVQFCFAAANSSCPRKARPALVVCAMYLIMIGAIVMTMLGNMAVIISIAHFKQLHSPTNFLILSMATTDF
LLSCVVMPFSMIRSIESCWYFG

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000286231 7TM_GPCR_Rhodpsn (53/264 aa) | 7TM_GPCR_olfarory/Srsx (58/282 aa) CDS CDS + stop codon + UTR
ENSMUSE00000286231 7TM_GPCR_Rhodpsn (213/264 aa) | 7TM_GPCR_olfarory/Srsx (226/282 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_D07 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_H09 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_C11 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_B06 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_H12 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_C07 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_G04 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_C10 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_G10 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_F05 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_F12 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_B07 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 423411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00283_Z_1_H03 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors no data available