IKMC Project Report - EUCOMM (ID: 114431)

Zfp36l3 MGI:3525151 ENSMUSG00000059334 OTTMUSG00000017388
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000165081 protein_coding Novel N-terminal, residual C-terminal product view

Predicted translation:

MVSRGQLVRCPGKLPMSPQRLTRCRRSTRGMANIACSRSLSHRR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000897401 Znf_CCCH (26/26 aa) | Znf_CCCH (27/27 aa) UTR + start codon + CDS UTR
ENSMUSE00000897401 Znf_CCCH (26/26 aa) | Znf_CCCH (27/27 aa) CDS + stop codon + UTR Deleted
ENSMUSE00000907440 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000071711 protein_coding No protein product view

Predicted translation:

MANNNLNRPLNTNVADSSNSSSTPGTAPPPSSSDPQVLGHQAPSSSASSLTEDCSSSFARDLNSYNNGQSGATGAVSWEA
PHEPSEANAVSQIHPRNGEHSLQQKPKPQKVSGSSSLATSERYKTELCRPFEESGICKYGHKCQFAHGYRELRTLSRHPK
YKTEPCRTFHSVGFCPYGTRCHFIHNQPEQQPVLSESTLEEPSSFNGSNVLHLGVNGEQQPGLQ

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000509517 Znf_CCCH (26/26 aa) | Znf_CCCH (27/27 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000509517 Znf_CCCH (26/26 aa) | Znf_CCCH (27/27 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available