IKMC Project Report - KOMP-CSD (ID: 115735)

Dhrs3 MGI:1315215 ENSMUSG00000066026 OTTMUSG00000010749
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000154208 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MVWKWLGALVVFPLQMIYLVTKAAVGMVLPPKLRDLSRESVLITGGGRGIGRHLAREFAERGARKIVLWGRTEKCLKETT
EEIRQMGTECHYFICDVGNREEVYQMAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHVNTLGQFWVSQPLPA
TEARDSSPEDGRCCATKPGPSLAPVDHEYPHYLEKHTPTSCTGGDSQVLGDLHLYEHL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000835579 DH_sc/Rdtase_SDR (25/164 aa) | PKS_KR (24/160 aa) | Polysac_CapD-like (24/71 aa) | Epimerase_deHydtase (24/99 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001068320 DH_sc/Rdtase_SDR (48/164 aa) | PKS_KR (48/160 aa) | Polysac_CapD-like (47/71 aa) | Epimerase_deHydtase (48/99 aa) CDS CDS
ENSMUSE00000524264 DH_sc/Rdtase_SDR (40/164 aa) | PKS_KR (40/160 aa) | Epimerase_deHydtase (27/99 aa) CDS CDS
ENSMUSE00001024473 DH_sc/Rdtase_SDR (51/164 aa) | PKS_KR (48/160 aa) CDS Deleted
ENSMUSE00001086758 CDS CDS
ENSMUSE00000767874 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000171001 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MVLPPKLRDLSRESVLITGGGRGIGRHLAREFAERGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQM
AKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHVNTLGQFWVSQPLPATEARDSSPEDGRCCATKPGPSLAPVD
HEYPHYLEKHTPTSCTGGDSQVLGDLHLYEHL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000667384 UTR UTR
ENSMUSE00000667383 DH_sc/Rdtase_SDR (25/164 aa) | PKS_KR (24/160 aa) | Polysac_CapD-like (24/71 aa) | Epimerase_deHydtase (24/99 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001068320 DH_sc/Rdtase_SDR (48/164 aa) | PKS_KR (48/160 aa) | Polysac_CapD-like (47/71 aa) | Epimerase_deHydtase (48/99 aa) CDS CDS
ENSMUSE00000524264 DH_sc/Rdtase_SDR (40/164 aa) | PKS_KR (40/160 aa) | Epimerase_deHydtase (27/99 aa) CDS CDS
ENSMUSE00001024473 DH_sc/Rdtase_SDR (51/164 aa) | PKS_KR (48/160 aa) CDS Deleted
ENSMUSE00001086758 CDS CDS
ENSMUSE00000910607 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000105744 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MVLPPKLRDLSRESVLITGGGRGIGRHLAREFAERGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQM
AKAVREKVSQPLPATEARDSSPEDGRCCATKPGPSLAPVDHEYPHYLEKHTPTSCTGGDSQVLGDLHLYEHL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000667384 UTR UTR
ENSMUSE00000667383 DH_sc/Rdtase_SDR (25/74 aa) | PKS_KR (24/74 aa) | Polysac_CapD-like (24/70 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001068320 DH_sc/Rdtase_SDR (48/74 aa) | PKS_KR (48/74 aa) | Polysac_CapD-like (46/70 aa) CDS CDS
ENSMUSE00001024473 DH_sc/Rdtase_SDR (1/74 aa) | PKS_KR (2/74 aa) CDS Deleted
ENSMUSE00001086758 CDS CDS
ENSMUSE00000667382 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000142808 protein_coding No analysis available: incomplete transcript
ENSMUST00000084184 nonsense_mediated_decay No protein product (NMD) view

Predicted translation:

MVWKWLGALVVFPLQMIYLVTKAAVGMVLPPKLRDLSRESVLITGGGRGIGRHLAREFAERGARKIVLWGRTEKCLKETT
EEIRQMGTECHYFICDVGNREEVYQMAKAVREKTQLVWHQRHL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000829045 DH_sc/Rdtase_SDR (25/75 aa) | PKS_KR (24/74 aa) | Polysac_CapD-like (24/79 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001068320 DH_sc/Rdtase_SDR (48/75 aa) | PKS_KR (48/74 aa) | Polysac_CapD-like (48/79 aa) CDS CDS
ENSMUSE00000996447 DH_sc/Rdtase_SDR (2/75 aa) | PKS_KR (2/74 aa) | Polysac_CapD-like (7/79 aa) CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001057839 UTR Deleted
ENSMUSE00001067408 UTR UTR
ENSMUSE00000828732 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000128926 processed_transcript No analysis available: incomplete transcript
ENSMUST00000133265 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available