IKMC Project Report - KOMP-CSD (ID: 115818)

2310045N01Rik MGI:1919618 ENSMUSG00000002345 OTTMUSG00000022206
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000002418 protein_coding No protein product view

Predicted translation:

MEEPEMQLKGKKVL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000744938 UPF0402_NEP (12/118 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001042887 UPF0402_NEP (38/118 aa) CDS Deleted
ENSMUSE00001072941 UPF0402_NEP (22/118 aa) CDS Deleted
ENSMUSE00000984239 UPF0402_NEP (38/118 aa) CDS CDS + stop codon + UTR
ENSMUSE00001000820 UPF0402_NEP (11/118 aa) CDS + stop codon + UTR
ENSMUSE00000213943 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000072500 protein_coding Target region does not overlap transcript
ENSMUST00000163756 protein_coding Design floxes no exons in transcript ENSMUST00000163756
ENSMUST00000164040 protein_coding Target region does not overlap transcript
ENSMUST00000110139 protein_coding No protein product view

Predicted translation:

MGALRVL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000682907 UPF0402_NEP (2/108 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001042887 UPF0402_NEP (38/108 aa) CDS Deleted
ENSMUSE00001072941 UPF0402_NEP (22/108 aa) CDS Deleted
ENSMUSE00000984239 UPF0402_NEP (38/108 aa) CDS CDS + stop codon + UTR
ENSMUSE00001000820 UPF0402_NEP (11/108 aa) CDS + stop codon + UTR
ENSMUSE00000682906 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000123760 nonsense_mediated_decay Residual N-terminal, novel C-terminal product view

Predicted translation:

MEEPEMQLKGKKEPTWWKKSTDSCRCPLTSTDASEDASPP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000726363 UPF0402_NEP (12/73 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001042887 UPF0402_NEP (38/73 aa) CDS Deleted
ENSMUSE00001072941 UPF0402_NEP (22/73 aa) CDS Deleted
ENSMUSE00001070815 UPF0402_NEP (3/73 aa) CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00000768356 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000123976 retained_intron No analysis available: incomplete transcript
ENSMUST00000129668 nonsense_mediated_decay No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available