IKMC Project Report - KOMP-CSD (ID: 115975)

Slc18b1 MGI:1923556 ENSMUSG00000037455 OTTMUSG00000030782
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000119597 protein_coding No protein product (NMD) view

Predicted translation:

MDEAGSPAPAGTGGGDDPGGSTRETSRRLSREQIFVLVSAASMNLGCMMTYSILGPFFPKEAEKKGASNTMIGMIFGCYA
LFELLASLVFGKYLVHIGAKFMFIAGMFVSGGVTILFGEVLRFFLDWGW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000721065 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000615427 MFS (16/191 aa) CDS CDS
ENSMUSE00000615426 MFS (32/191 aa) CDS CDS
ENSMUSE00000615425 MFS (25/191 aa) CDS CDS
ENSMUSE00000615424 MFS (50/191 aa) CDS Deleted
ENSMUSE00000644551 MFS (53/191 aa) CDS CDS + stop codon + UTR
ENSMUSE00001011236 MFS (17/191 aa) | MFS (24/202 aa) CDS
ENSMUSE00000282805 MFS (34/202 aa) CDS
ENSMUSE00000282798 MFS (31/202 aa) CDS
ENSMUSE00000282792 MFS (33/202 aa) CDS
ENSMUSE00000282783 MFS (26/202 aa) CDS
ENSMUSE00000964030 MFS (32/202 aa) CDS
ENSMUSE00000982832 MFS (18/202 aa) CDS
ENSMUSE00000715825 MFS (8/202 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000179321 protein_coding No protein product (NMD) view

Predicted translation:

MDEAGSPAPAGTGGGDDPGGSTRETSRRLSREQIFVLVSAASMNLGCMMTYSILGPFFPKEAEKKGASNTMIGMIFGCYA
LFELLASLVFGKYLVHIGAKFMFIAGMFVSGGVTILFGEVLRFFLDWGW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000721065 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000615427 MFS (16/309 aa) CDS CDS
ENSMUSE00000615426 MFS (32/309 aa) CDS CDS
ENSMUSE00000615425 MFS (25/309 aa) CDS CDS
ENSMUSE00000615424 MFS (50/309 aa) CDS Deleted
ENSMUSE00000644551 MFS (53/309 aa) CDS CDS + stop codon + UTR
ENSMUSE00000978549 MFS (48/309 aa) | MFS (24/202 aa) | LacY_symp (23/166 aa) CDS
ENSMUSE00000282805 MFS (34/309 aa) | MFS (34/202 aa) | LacY_symp (34/166 aa) CDS
ENSMUSE00000282798 MFS (31/309 aa) | MFS (31/202 aa) | LacY_symp (31/166 aa) CDS
ENSMUSE00000282792 MFS (23/309 aa) | MFS (33/202 aa) | LacY_symp (33/166 aa) CDS
ENSMUSE00000282783 MFS (26/202 aa) | LacY_symp (26/166 aa) CDS
ENSMUSE00000964030 MFS (32/202 aa) | LacY_symp (22/166 aa) CDS
ENSMUSE00000982832 MFS (18/202 aa) CDS
ENSMUSE00000715825 MFS (8/202 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000133289 protein_coding No analysis available: incomplete transcript
ENSMUST00000134170 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000127841 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000143931 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available