IKMC Project Report - KOMP-CSD (ID: 116617)

Gabrr1 MGI:95625 ENSMUSG00000028280 OTTMUSG00000004921
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000029947 protein_coding No protein product (NMD) view

Predicted translation:

MKFGIFLLWWGWVLAAESTAHWPGREVHEPSRKGSRPQRQRRGAHDDAHKQGSPILRRSSDITKSPLTKSEQLLRIDDHD
FSMRPGFGELQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000235409 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000235400 CDS CDS
ENSMUSE00000406461 Neur_chan_lig-bd (12/199 aa) CDS CDS
ENSMUSE00001083198 Neur_chan_lig-bd (23/199 aa) CDS Deleted
ENSMUSE00001037103 Neur_chan_lig-bd (75/199 aa) CDS Deleted
ENSMUSE00000177826 Neur_chan_lig-bd (29/199 aa) CDS CDS + stop codon + UTR
ENSMUSE00001085275 Neur_chan_lig-bd (48/199 aa) CDS
ENSMUSE00000177813 Neur_chan_lig-bd (16/199 aa) | Neurotrans-gated_channel_TM (29/97 aa) CDS
ENSMUSE00000975591 Neurotrans-gated_channel_TM (66/97 aa) CDS
ENSMUSE00000235367 Neurotrans-gated_channel_TM (3/97 aa) | Neurotrans-gated_channel_TM (28/28 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available