IKMC Project Report - EUCOMM (ID: 116953)
Shmt2 MGI:1277989 ENSMUSG00000025403
Mice no data available
Mutagenesis Predictions
This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000026470 | protein_coding | Residual N-terminal, unknown C-terminal | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MVSFSLLRTTRPLQRCGQLVCMAARAQHSKVAQTQAGEAAGGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASE
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | HEPD0856_3_A06 | ETPG00276_Z_4_D07 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8.N4 | view | no | view ( about ) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 441065 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00276_Z_4_D07 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 441065 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | ETPG00276_Z_D07 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |