IKMC Project Report - EUCOMM (ID: 117226)

Yaf2 MGI:1914307 ENSMUSG00000022634 OTTMUSG00000017284
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000080299 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MGDKKSPTRPKRQPKPASDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTR

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000805184 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001087239 Znf_RanBP2 (24/24 aa) CDS CDS
ENSMUSE00001020082 CDS Deleted
ENSMUSE00000552993 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000133736 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 440443 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00276_Z_8_C10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view

Intermediate Vectors no data available