IKMC Project Report - EUCOMM (ID: 117447)

1600016N20Rik MGI:1919250 ENSMUSG00000025500
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000170841 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MAPKSCQESEDKQVSPAPAGVQPDSSDLGSPVGTPVDRVAPSYSQSAKLYTSTPMGCSVKQQLAPETLDPRTLRLLWEQR
ELEIQALRWAVQNGHNARYSSILQEVAGVPSERLRGMIAPPTRNSKSQDKFLRNQVQKLTLELKAQKEQAQQEKQQLEEK
LQQNLWAKQQLEAELQTFQKSCLLQLARSSWVGRVLRSQTGSVEVVTTEVLRDPSDFSESAEIPTSGEGFPLEDVDWNSI
AQRYPNLFSNLNFYSDQKQSQPPTSETYTLDSEGATKHTEKPTKILEWSALPLLDLCKSHSPSCSKTVLESYTDLHHPYT
RPQLNPFGCCLKIAAVSHREKFIRVINQSQAETIDLGGFVLQQLVRDFPVCMYRFPPGTLLAPQHHITVWGEGTSRTKKQ
LPVASGQDPFQFQSSRGCVTVLVNPQGQVLSEHQATPCVTLGSKIFTDNTDWSIDCFPLSESEPDVHPGEQQCRPSSPQK
GRAKDAGARRKKPGPGVRQHRHSSTSGLRASRTLHPTETRDILPLLSSRKLLPSGEVLTQQEGVKAETSELLPVIPECPS
RLCLGEDSLGRQEYKVQVCRKSVDLSCPMVALSVQNTAESRYGFRFLCYPPITEELCRRL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000668340 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000668339 CDS CDS
ENSMUSE00000915570 CDS CDS
ENSMUSE00000668337 CDS CDS
ENSMUSE00000668336 CDS CDS
ENSMUSE00000668335 CDS CDS
ENSMUSE00000668334 CDS CDS
ENSMUSE00000668334 CDS Deleted
ENSMUSE00000668333 CDS CDS
ENSMUSE00000631789 Lamin_tail_dom (56/97 aa) CDS CDS
ENSMUSE00000335328 Lamin_tail_dom (40/97 aa) CDS CDS
ENSMUSE00000151193 Lamin_tail_dom (1/97 aa) CDS CDS
ENSMUSE00000151195 CDS CDS
ENSMUSE00000151194 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000026573 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MAPKSCQESEDKQVSPAPAGVQPDSSDLGSPVGTPVDRVAPSYSQSAKLYTSTPMGCSVKQQLAPETLDPRTLRLLWEQR
ELEIQALRWAVQNGHNARYSSILQEVAGVPSERNSKSQDKFLRNQVQKLTLELKAQKEQAQQEKQQLEEKLQQNLWAKQQ
LEAELQTFQKSCLLQLARSSWVGRVLRSQTGSVEVVTTEVLRDPSDFSESAEIPTSGEGFPLEDVDWNSIAQRYPNLFSN
LNFYSDQKQSQPPTSETYTLDSEGATKHTEKPTKILEWSALPLLDLCKSHSPSCSKTVLESYTDLHHPYTRPQLNPFGCC
LKIAAVSHREKFIRVINQSQAETIDLGGFVLQQLVRDFPVCMYRFPPGTLLAPQHHITVWGEGTSRTKKQLPVASGQDPF
QFQSSRGCVTVLVNPQGQVLSEHQATPCVTLGSKIFTDNTDWSIDCFPLSESEPDVHPGEQQCRPSSPQKGRAKDAGARR
KKPGPGVRQHRHSSTSGLRASRTLHPTETRDILPLLSSRKLLPSGEVLTQQEGVKAETSELLPVIPECPSRLCLGEDSLG
RQEYKVQVCRKSVDLSCPMVALSVQNTAESRYGFRFLCYPPITEELCRRL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000908960 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000668339 CDS CDS
ENSMUSE00000668338 CDS CDS
ENSMUSE00000668337 CDS CDS
ENSMUSE00000668336 CDS CDS
ENSMUSE00000668335 CDS CDS
ENSMUSE00000668334 CDS CDS
ENSMUSE00000668334 CDS Deleted
ENSMUSE00000668333 CDS CDS
ENSMUSE00000631789 Lamin_tail_dom (56/97 aa) CDS CDS
ENSMUSE00000335328 Lamin_tail_dom (40/97 aa) CDS CDS
ENSMUSE00000151193 Lamin_tail_dom (1/97 aa) CDS CDS
ENSMUSE00000151195 CDS CDS
ENSMUSE00000151194 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0850_4_C06 ETPG00277_Z_7_G01 1600016N20Riktm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0850_4_B05 ETPG00277_Z_7_G01 1600016N20Riktm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0850_4_A04 ETPG00277_Z_7_G01 1600016N20Riktm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0850_4_D04 ETPG00277_Z_7_G01 1600016N20Riktm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0850_4_H04 ETPG00277_Z_7_G01 1600016N20Riktm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0850_4_E06 ETPG00277_Z_7_G01 1600016N20Riktm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0850_4_G06 ETPG00277_Z_7_G01 1600016N20Riktm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0850_4_F05 ETPG00277_Z_7_G01 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0850_4_D06 ETPG00277_Z_7_G01 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0850_4_A05 ETPG00277_Z_7_G01 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0850_4_A06 ETPG00277_Z_7_G01 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0850_4_F06 ETPG00277_Z_7_G01 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0850_4_C05 ETPG00277_Z_7_G01 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_G01 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_X_6_F03 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_B10 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_A02 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_A12 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_H10 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_A10 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_A09 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_C10 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_F02 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_A07 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_X_6_E10 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_X_6_G01 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_E05 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_X_6_E06 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_C02 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_E03 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_E01 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_B06 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_G08 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_E11 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_H09 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_B05 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 428772 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00277_Z_7_G10 Ifitm2_intron_L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors no data available