IKMC Project Report - EUCOMM (ID: 117545)

Treml4 MGI:1923239 ENSMUSG00000051682 OTTMUSG00000028419
Pre-pipeline Designs Vectors ES Cells Mice
Design Completed

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000154335 protein_coding No protein product (NMD) view

Predicted translation:

MAWRYSQLLLVPVQLVFLASVCCPGVWGSTVSEELHRMVGQSLSVQCQYKPKEESYVLKTWCRQTAPSKCTSPINPSFAD
DCSAPRKHSSHHLYALPSSDYLSRGDH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000823894 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000335876 Ig_V-set (39/92 aa) CDS CDS
ENSMUSE00000335876 Ig_V-set (53/92 aa) CDS Deleted
ENSMUSE00000383422 CDS CDS
ENSMUSE00000743825 CDS CDS + stop codon + UTR
ENSMUSE00000359086 CDS
ENSMUSE00000809796 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000059873 protein_coding No protein product (NMD) view

Predicted translation:

MAWRYSQLLLVPVQLVFLASVCCPGVWGSTVSEELHRMVGQSLSVQCQYKPKEESYVLKTWCRQTAPSKCTSPINPSFAD
DCSAPRKHSHHLYALPSSDYLSRGDH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000354988 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000335876 Ig_V-set (39/92 aa) CDS CDS
ENSMUSE00000335876 Ig_V-set (53/92 aa) CDS Deleted
ENSMUSE00000383422 CDS CDS
ENSMUSE00000344139 CDS CDS + stop codon + UTR
ENSMUSE00000359086 CDS
ENSMUSE00001088877 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000125426 protein_coding No protein product (NMD) view

Predicted translation:

MAWRYSQLLLVPVQLVFLASGVWGSTVSEELHRMVGQSLSVQCQYKPKEESYVLKTWCRQTAPSKCTSPINPSFADDCSA
PRKHSHHLYALPSSDYLSRGDH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000827864 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000843325 Ig_V-set (39/92 aa) CDS CDS
ENSMUSE00000843325 Ig_V-set (53/92 aa) CDS Deleted
ENSMUSE00000383422 CDS CDS
ENSMUSE00000344139 CDS CDS + stop codon + UTR
ENSMUSE00000359086 CDS
ENSMUSE00000758859 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000136272 protein_coding No protein product (NMD) view

Predicted translation:

MAWRYSQLLLVPVQLVFLASVCCPGVWGSTVSEELHRMVGQSLSVQCQYKPKEESYVLKTWCRQTAPSKCTSPINPSFAD
DCSAPRKHSSDYLSRGDH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000823894 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000335876 Ig_V-set (39/92 aa) CDS CDS
ENSMUSE00000335876 Ig_V-set (53/92 aa) CDS Deleted
ENSMUSE00000383422 CDS CDS
ENSMUSE00000778315 CDS CDS + stop codon + UTR
ENSMUSE00000359086 CDS
ENSMUSE00000809796 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000153420 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MAWRYSQLLLVPVQLVFLASVCCPGVWGSTVSEELHRMVGQSLSVQCQYKPKEESYVLKTWCRQTAPSKCTSPINPSFAD
DCSAPRKHSHHLYALPSSDYLSRGDH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000736421 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000335876 Ig_V-set (39/92 aa) CDS CDS
ENSMUSE00000335876 Ig_V-set (53/92 aa) CDS Deleted
ENSMUSE00000383422 CDS CDS
ENSMUSE00000344139 CDS CDS + stop codon + UTR
ENSMUSE00000753725 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000153131 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available