IKMC Project Report - EUCOMM (ID: 117547)

Jakmip1 MGI:1923321 ENSMUSG00000063646 OTTMUSG00000026769
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 12 wild type transcripts, of which 7 are protein-coding. Following removal of the floxed region, 7 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000043794 protein_coding No protein product (NMD) view

Predicted translation: 

MSKKGRSKGDKPEAETDSVQMANEELRAKLTNIQIEFQQEKSKVGKLRERLQEAKLEREQEQRRHTAYISELKAKLHEEK
TKELQALREALIRQHEQEAARTAKIKEDGRDQREGAGDPGPGEGAWCANRADPAAAVTEGGSG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000932892 UTR UTR
ENSMUSE00000404674 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000285025 CDS CDS
ENSMUSE00000285025 CDS Deleted
ENSMUSE00000285017 CDS CDS + stop codon + UTR
ENSMUSE00000285010 CDS
ENSMUSE00000285004 CDS
ENSMUSE00000284996 CDS
ENSMUSE00000284985 CDS
ENSMUSE00000284977 CDS
ENSMUSE00000284970 CDS
ENSMUSE00000508795 CDS
ENSMUSE00000284961 CDS
ENSMUSE00000284957 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000121010 protein_coding No analysis available: incomplete transcript
ENSMUST00000174629 protein_coding No analysis available: incomplete transcript
ENSMUST00000137019 protein_coding No analysis available: incomplete transcript
ENSMUST00000172917 protein_coding No analysis available: incomplete transcript
ENSMUST00000173836 protein_coding No analysis available: incomplete transcript
ENSMUST00000174097 protein_coding Target region does not overlap transcript
ENSMUST00000152445 retained_intron Target region does not overlap transcript
ENSMUST00000147014 retained_intron Target region does not overlap transcript
ENSMUST00000126527 retained_intron Target region does not overlap transcript
ENSMUST00000172940 processed_transcript Target region does not overlap transcript
ENSMUST00000173048 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available