IKMC Project Report - EUCOMM (ID: 117567)

1700123K08Rik MGI:1923908 ENSMUSG00000029526
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000031501 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MFSCFQASRGSGHKKAKRGRLVCFWRRLIRPLTHLRHASHSEPKVCCENDQEPDSMPKHPQFNYKSREYVQQMIHYIPAA
IQNRDHLCLDIFVAMYQTYATTWEVLDLLMKT

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001056093 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001029225 CDS CDS
ENSMUSE00001085552 CDS Deleted
ENSMUSE00000975952 CDS Deleted
ENSMUSE00000475533 CDS Deleted
ENSMUSE00000189808 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0846_8_F04 ETPG00276_Y_8_G09 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 428891 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00276_Y_8_G09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 428891 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00276_Z_8_G09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors no data available