IKMC Project Report - EUCOMM (ID: 117727)

AI413582 MGI:2146839 ENSMUSG00000062753 OTTMUSG00000028934
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000154473 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MSNTTVPNAPQANSDSMVGYVLGPFFLITLVGVVVAV

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000833202 UTR UTR
ENSMUSE00001060186 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000610290 CDS Deleted
ENSMUSE00000355573 CDS Deleted
ENSMUSE00000811554 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000080190 nonsense_mediated_decay Residual N-terminal, unknown C-terminal view

Predicted translation:

MSNTTVPNAPQANSDSMVGYVLGPFFLITLVGVVVAV

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000700949 UTR UTR
ENSMUSE00001060186 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000806748 CDS + stop codon + UTR Deleted
ENSMUSE00000657941 UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000138728 retained_intron No analysis available: incomplete transcript
ENSMUST00000145183 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available