IKMC Project Report - EUCOMM (ID: 117744)

A1bg MGI:2152878 ENSMUSG00000022347
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000096418 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MSLLATVLLLWGFTLGPGNTLMLDSGSEPKLWAEPQSLLEPWANLTLVCAVDLPTKVFELIQNGWFLSQVRLETQVLSYR
FSLGAITSNNSGIYRCRCGVEPPVDIHLPALNKWTMLSNAVEVTGK

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000623758 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000623736 CDS CDS
ENSMUSE00000236047 CDS CDS + stop codon + UTR
ENSMUSE00000125715 CDS Deleted
ENSMUSE00000125712 CDS Deleted
ENSMUSE00000236027 CDS Deleted
ENSMUSE00000623738 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0860_7_G02 ETPG00282_Y_4_D12 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 444905 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) ETPG00282_Y_4_D12 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view

Intermediate Vectors no data available