IKMC Project Report - EUCOMM (ID: 118243)

Jak3 MGI:99928 ENSMUSG00000031805 OTTMUSG00000021111
Pre-pipeline Designs Vectors ES Cells Mice
Design Completed

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000051995 protein_coding No protein product (NMD) view

Predicted translation:

MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKACAFPDLL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000682378 UTR UTR
ENSMUSE00001087047 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001004544 CDS Deleted
ENSMUSE00001006480 CDS Deleted
ENSMUSE00000995935 CDS Deleted
ENSMUSE00000328693 CDS Deleted
ENSMUSE00000329361 CDS CDS + stop codon + UTR
ENSMUSE00000329356 CDS
ENSMUSE00000329342 CDS
ENSMUSE00001024276 CDS
ENSMUSE00001090540 Ser-Thr/Tyr_kinase_cat_dom (2/257 aa) CDS
ENSMUSE00000995061 Ser-Thr/Tyr_kinase_cat_dom (44/257 aa) | Prot_kinase_cat_dom (44/253 aa) CDS
ENSMUSE00000997084 Ser-Thr/Tyr_kinase_cat_dom (29/257 aa) | Prot_kinase_cat_dom (29/253 aa) CDS
ENSMUSE00000984435 Ser-Thr/Tyr_kinase_cat_dom (43/257 aa) | Prot_kinase_cat_dom (43/253 aa) CDS
ENSMUSE00000988802 Ser-Thr/Tyr_kinase_cat_dom (45/257 aa) | Prot_kinase_cat_dom (45/253 aa) CDS
ENSMUSE00001078173 Ser-Thr/Tyr_kinase_cat_dom (51/257 aa) | Prot_kinase_cat_dom (51/253 aa) CDS
ENSMUSE00001032852 Ser-Thr/Tyr_kinase_cat_dom (45/257 aa) | Prot_kinase_cat_dom (43/253 aa) CDS
ENSMUSE00001061223 Ser-Thr/Tyr_kinase_cat_dom (7/272 aa) | Prot_kinase_cat_dom (5/264 aa) CDS
ENSMUSE00001037435 Ser-Thr/Tyr_kinase_cat_dom (64/272 aa) | Prot_kinase_cat_dom (64/264 aa) CDS
ENSMUSE00001072401 Ser-Thr/Tyr_kinase_cat_dom (42/272 aa) | Prot_kinase_cat_dom (42/264 aa) CDS
ENSMUSE00001019221 Ser-Thr/Tyr_kinase_cat_dom (58/272 aa) | Prot_kinase_cat_dom (58/264 aa) CDS
ENSMUSE00000980968 Ser-Thr/Tyr_kinase_cat_dom (40/272 aa) | Prot_kinase_cat_dom (40/264 aa) CDS
ENSMUSE00001074812 Ser-Thr/Tyr_kinase_cat_dom (37/272 aa) | Prot_kinase_cat_dom (37/264 aa) CDS
ENSMUSE00001001023 Ser-Thr/Tyr_kinase_cat_dom (26/272 aa) | Prot_kinase_cat_dom (20/264 aa) CDS + stop codon + UTR
ENSMUSE00001082089 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000110013 protein_coding No protein product (NMD) view

Predicted translation:

MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKACAFPDLL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000682378 UTR UTR
ENSMUSE00001087047 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001004544 CDS Deleted
ENSMUSE00001006480 CDS Deleted
ENSMUSE00000995935 CDS Deleted
ENSMUSE00000328693 CDS Deleted
ENSMUSE00000329361 CDS CDS + stop codon + UTR
ENSMUSE00000329356 CDS
ENSMUSE00000329342 CDS
ENSMUSE00001024276 CDS
ENSMUSE00001090540 Ser-Thr/Tyr_kinase_cat_dom (2/257 aa) CDS
ENSMUSE00000995061 Ser-Thr/Tyr_kinase_cat_dom (44/257 aa) | Prot_kinase_cat_dom (44/253 aa) CDS
ENSMUSE00000997084 Ser-Thr/Tyr_kinase_cat_dom (29/257 aa) | Prot_kinase_cat_dom (29/253 aa) CDS
ENSMUSE00000984435 Ser-Thr/Tyr_kinase_cat_dom (43/257 aa) | Prot_kinase_cat_dom (43/253 aa) CDS
ENSMUSE00000988802 Ser-Thr/Tyr_kinase_cat_dom (45/257 aa) | Prot_kinase_cat_dom (45/253 aa) CDS
ENSMUSE00001078173 Ser-Thr/Tyr_kinase_cat_dom (51/257 aa) | Prot_kinase_cat_dom (51/253 aa) CDS
ENSMUSE00001032852 Ser-Thr/Tyr_kinase_cat_dom (45/257 aa) | Prot_kinase_cat_dom (43/253 aa) CDS
ENSMUSE00001061223 Ser-Thr/Tyr_kinase_cat_dom (7/272 aa) | Prot_kinase_cat_dom (5/264 aa) CDS
ENSMUSE00001037435 Ser-Thr/Tyr_kinase_cat_dom (64/272 aa) | Prot_kinase_cat_dom (64/264 aa) CDS
ENSMUSE00001072401 Ser-Thr/Tyr_kinase_cat_dom (42/272 aa) | Prot_kinase_cat_dom (42/264 aa) CDS
ENSMUSE00001019221 Ser-Thr/Tyr_kinase_cat_dom (58/272 aa) | Prot_kinase_cat_dom (58/264 aa) CDS
ENSMUSE00000980968 Ser-Thr/Tyr_kinase_cat_dom (40/272 aa) | Prot_kinase_cat_dom (40/264 aa) CDS
ENSMUSE00001074812 Ser-Thr/Tyr_kinase_cat_dom (37/272 aa) | Prot_kinase_cat_dom (37/264 aa) CDS
ENSMUSE00000682376 Ser-Thr/Tyr_kinase_cat_dom (26/272 aa) | Prot_kinase_cat_dom (20/264 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000110012 protein_coding No protein product (NMD) view

Predicted translation:

MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKACAFPDLL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000682370 UTR UTR
ENSMUSE00001087047 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001004544 CDS Deleted
ENSMUSE00001006480 CDS Deleted
ENSMUSE00000995935 CDS Deleted
ENSMUSE00000328693 CDS Deleted
ENSMUSE00000329361 CDS CDS + stop codon + UTR
ENSMUSE00000329356 CDS
ENSMUSE00000329342 CDS
ENSMUSE00001024276 CDS
ENSMUSE00001090540 Ser-Thr/Tyr_kinase_cat_dom (2/257 aa) CDS
ENSMUSE00000995061 Ser-Thr/Tyr_kinase_cat_dom (44/257 aa) | Prot_kinase_cat_dom (44/253 aa) CDS
ENSMUSE00000997084 Ser-Thr/Tyr_kinase_cat_dom (29/257 aa) | Prot_kinase_cat_dom (29/253 aa) CDS
ENSMUSE00000984435 Ser-Thr/Tyr_kinase_cat_dom (43/257 aa) | Prot_kinase_cat_dom (43/253 aa) CDS
ENSMUSE00000988802 Ser-Thr/Tyr_kinase_cat_dom (45/257 aa) | Prot_kinase_cat_dom (45/253 aa) CDS
ENSMUSE00001078173 Ser-Thr/Tyr_kinase_cat_dom (51/257 aa) | Prot_kinase_cat_dom (51/253 aa) CDS
ENSMUSE00001032852 Ser-Thr/Tyr_kinase_cat_dom (45/257 aa) | Prot_kinase_cat_dom (43/253 aa) CDS
ENSMUSE00001061223 Ser-Thr/Tyr_kinase_cat_dom (7/272 aa) | Prot_kinase_cat_dom (5/264 aa) CDS
ENSMUSE00001037435 Ser-Thr/Tyr_kinase_cat_dom (64/272 aa) | Prot_kinase_cat_dom (64/264 aa) CDS
ENSMUSE00001072401 Ser-Thr/Tyr_kinase_cat_dom (42/272 aa) | Prot_kinase_cat_dom (42/264 aa) CDS
ENSMUSE00001019221 Ser-Thr/Tyr_kinase_cat_dom (58/272 aa) | Prot_kinase_cat_dom (58/264 aa) CDS
ENSMUSE00000980968 Ser-Thr/Tyr_kinase_cat_dom (40/272 aa) | Prot_kinase_cat_dom (40/264 aa) CDS
ENSMUSE00001074812 Ser-Thr/Tyr_kinase_cat_dom (37/272 aa) | Prot_kinase_cat_dom (37/264 aa) CDS
ENSMUSE00000682369 Ser-Thr/Tyr_kinase_cat_dom (26/272 aa) | Prot_kinase_cat_dom (20/264 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000130624 retained_intron No analysis available: incomplete transcript
ENSMUST00000133263 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available