International Knockout Mouse Consortium - MartSearch

This gene has 4 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

MDSRNVLIIYAVNVERKLNAAAHHTSEYQTKKLVLRRGQIFTLKVILNRPLQPQDELKVTFTSGYSECHQCC*