IKMC Project Report - KOMP-CSD (ID: 118410)

Hoxa2 MGI:96174 ENSMUSG00000014704 OTTMUSG00000037358
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000014848 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGVGGRPKSSPA
GSRGSPVPAGALQPPEYPWMKEKKAAKKTALPPAAASTGPACLGHK

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000193269 UTR + start codon + CDS
ENSMUSE00000387033 Homeodomain (57/57 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 86337 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) MOHFA0006_B_2_A01 L1L2_gt1_Del_LacZ R3R4_pBR_amp view
order 86337 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) MOHFA0006_B_3_A02 L1L2_gt1_Del_LacZ R3R4_pBR_amp view
order 86337 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) MOHFA0006_B_5_A01 L1L2_gt1_Del_LacZ R3R4_pBR_amp view
order 86337 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) MOHFAS5006_Z_A02 L1L2_gt1_Del_LacZ R3R4_pBR_amp view
order 86337 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) MOHFA0006_B_8_A02 L1L2_gt1_Del_LacZ R3R4_pBR_amp view
order 86337 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) MOHFA0006_B_7_A02 L1L2_gt1_Del_LacZ R3R4_pBR_amp view
order 86337 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) MOHFA0006_B_1_A02 L1L2_gt1_Del_LacZ R3R4_pBR_amp view
order 86337 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) MOHFA0006_B_6_A02 L1L2_gt1_Del_LacZ R3R4_pBR_amp view
order 86337 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) MOHFA0006_B_3_A01 L1L2_gt1_Del_LacZ R3R4_pBR_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
86337 Knockout-First - Reporter Tagged Insertion MOHPC10006_A_A01
86337 Knockout-First - Reporter Tagged Insertion MOHPC10006_A_A02