IKMC Project Report - EUCOMM (ID: 118717)

Nabp2 MGI:1917167 ENSMUSG00000025374 OTTMUSG00000035847
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 9 wild type transcripts, of which 7 are protein-coding. Following removal of the floxed region, 7 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000026439 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation:

MTTETFVKDIKPGLKNLNLIFIVLETASENQNGNGLSTQLGPVGGPHPSHTPSHPPSTRITRSQPNHTPSGPPGPSSNPV
SNGKETRRSSKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000400333 UTR UTR
ENSMUSE00001066706 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000983155 NA-bd_OB_tRNA-helicase (46/58 aa) CDS Deleted
ENSMUSE00001023095 NA-bd_OB_tRNA-helicase (13/58 aa) CDS Deleted
ENSMUSE00001051908 CDS Deleted
ENSMUSE00001062722 CDS Deleted
ENSMUSE00000406691 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000166608 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation:

MRVQEDLPTGCHGSGSMTTETFVKDIKPGLKNLNLIFIVLETASENQNGNGLSTQLGPVGGPHPSHTPSHPPSTRITRSQ
PNHTPSGPPGPSSNPVSNGKETRRSSKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000886705 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000968732 CDS CDS
ENSMUSE00000983155 NA-bd_OB_tRNA-helicase (46/58 aa) CDS Deleted
ENSMUSE00001023095 NA-bd_OB_tRNA-helicase (13/58 aa) CDS Deleted
ENSMUSE00001051908 CDS Deleted
ENSMUSE00001062722 CDS Deleted
ENSMUSE00000883024 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000164199 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation:

MTTETFVKDIKPGLKNLNLIFIVLETASENQNGNGLSTQLGPVGGPHPSHTPSHPPSTRITRSQPNHTPSGPPGPSSNPV
SNGKETRRSSKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000887882 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000983155 NA-bd_OB_tRNA-helicase (46/58 aa) CDS Deleted
ENSMUSE00001023095 NA-bd_OB_tRNA-helicase (13/58 aa) CDS Deleted
ENSMUSE00001051908 CDS Deleted
ENSMUSE00001062722 CDS Deleted
ENSMUSE00000406691 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000172348 protein_coding No protein product view

Predicted translation:

MTTETFVKDIKPGLKNLNLIFIVLETASENQNGN

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000892901 UTR UTR
ENSMUSE00001066706 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000983155 NA-bd_OB_tRNA-helicase (46/58 aa) CDS Deleted
ENSMUSE00001023095 NA-bd_OB_tRNA-helicase (13/58 aa) CDS Deleted
ENSMUSE00001051908 CDS Deleted
ENSMUSE00001062722 CDS Deleted
ENSMUSE00000872719 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000164664 protein_coding No protein product view

Predicted translation:

MTTETFVKDIKPGLKNLNLIFIVLETASENQ

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000894384 UTR UTR
ENSMUSE00001066706 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000983155 NA-bd_OB_tRNA-helicase (46/58 aa) CDS Deleted
ENSMUSE00001023095 NA-bd_OB_tRNA-helicase (13/58 aa) CDS Deleted
ENSMUSE00001051908 CDS Deleted
ENSMUSE00001062722 CDS Deleted
ENSMUSE00001077890 CDS + stop codon + UTR CDS
Legend: in frame deleted frameshifted
ENSMUST00000171494 protein_coding No analysis available: incomplete transcript
ENSMUST00000171370 protein_coding No analysis available: incomplete transcript
ENSMUST00000172238 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000167456 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available