IKMC Project Report - EUCOMM (ID: 118850)

Fhl2 MGI:1338762 ENSMUSG00000008136
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000008280 protein_coding No protein product (NMD) view

Predicted translation: 

MTERFDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKVPARWNTRAAAGTRPASPVSAASSPLEP
RASYLRRIRTSACPAMRSSMPCSACSAKSLSPQEVLLTGSSPGTRNALCAQPARSSYLGNASQHGMSFHTA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000343483 UTR UTR
ENSMUSE00000155420 Znf_LIM (12/57 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000549207 Znf_LIM (45/57 aa) | Znf_LIM (10/57 aa) CDS Deleted
ENSMUSE00000308061 Znf_LIM (48/57 aa) | Znf_LIM (5/55 aa) CDS CDS
ENSMUSE00000308057 Znf_LIM (50/55 aa) | Znf_LIM (9/55 aa) CDS CDS + stop codon + UTR
ENSMUSE00000375499 Znf_LIM (47/55 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0914_1_C10 PG00221_Z_1_E01 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 92540 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00221_Z_1_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
92540 Knockout First, Reporter-tagged insertion with conditional potential PCTS00221_A_E01