IKMC Project Report - EUCOMM (ID: 119499)

Wdr83 MGI:1915086 ENSMUSG00000005150 OTTMUSG00000029968
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000093357 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MAFPEPKPRAPELPQKRMKTLDCSQGAVRAVRFNGCLGTGPACGF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000781024 WD40_repeat (16/35 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001075802 WD40_repeat (20/35 aa) | WD40_repeat (18/39 aa) CDS Deleted
ENSMUSE00000211876 WD40_repeat (22/39 aa) | WD40_repeat (11/39 aa) CDS Deleted
ENSMUSE00000968758 WD40_repeat (17/39 aa) CDS Deleted
ENSMUSE00001093130 WD40_repeat (12/39 aa) | WD40_repeat (25/34 aa) CDS Deleted
ENSMUSE00000969314 WD40_repeat (10/34 aa) CDS Deleted
ENSMUSE00001039637 WD40_repeat (26/26 aa) | WD40_repeat (3/39 aa) CDS Deleted
ENSMUSE00000995829 WD40_repeat (37/39 aa) CDS Deleted
ENSMUSE00001019776 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000152785 protein_coding No analysis available: incomplete transcript
ENSMUST00000142201 protein_coding No analysis available: incomplete transcript
ENSMUST00000149050 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000152186 retained_intron No analysis available: incomplete transcript
ENSMUST00000136696 retained_intron No analysis available: incomplete transcript
ENSMUST00000131909 retained_intron No analysis available: incomplete transcript
ENSMUST00000135463 retained_intron No analysis available: incomplete transcript
ENSMUST00000146900 retained_intron No analysis available: incomplete transcript
ENSMUST00000145880 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available