IKMC Project Report - EUCOMM (ID: 119695)
Slc18b1 MGI:1923556 ENSMUSG00000037455 OTTMUSG00000030782
Mice no data available
Mutagenesis Predictions
This gene has 6 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000119597 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MDEAGSPAPAGTGGGDDPGGSTRETSRRLSREQIFVLVSAASMNLGCMMTYSILGPFFPKEAEKKGASNTMIGMIFGCYA LFELLASLVFGKYLVHIGAKFMFIAGMFVSGGVTILFGEVLRFFLDWGW*
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000179321 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MDEAGSPAPAGTGGGDDPGGSTRETSRRLSREQIFVLVSAASMNLGCMMTYSILGPFFPKEAEKKGASNTMIGMIFGCYA LFELLASLVFGKYLVHIGAKFMFIAGMFVSGGVTILFGEVLRFFLDWGW*
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000133289 | protein_coding | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000134170 | nonsense_mediated_decay | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000127841 | nonsense_mediated_decay | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000143931 | retained_intron | Target region does not overlap transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones no data available
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00265_Z_3_E07 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00265_Z_7_E07 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00265_Z_2_E07 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00265_Z_4_E07 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PRPGS00265_A_1_D10 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00265_Z_1_E07 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00265_Z_8_E07 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00265_Y_1_E07 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00265_Z_6_E07 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PRPGS00265_B_1_A01 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00265_Z_5_E07 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00265_Y_3_E07 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 376835 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00265_Y_2_E07 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |