IKMC Project Report - EUCOMM (ID: 120082)

1700017D01Rik MGI:1916619 ENSMUSG00000024729
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000025635 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MSINEVSTFYIIKEDTIAMGGAQIMLGLIHNALGTLWLSLHNLEDKRYSIGHKLMLASICYLFVSGTFFINSGSSSITQG
ISSVFQHMFAIITNIISIFVAIFGLILLGYEFPIFESIGTEYIWSNFSQVPPIHTYHHHLQHSHLCLSWRMSLNNPIQKI
*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000506987 UTR UTR
ENSMUSE00000521180 CD20-like (1/95 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000520178 CD20-like (48/95 aa) CDS CDS
ENSMUSE00000512071 CD20-like (18/95 aa) CDS CDS
ENSMUSE00000144554 CD20-like (28/95 aa) CDS CDS
ENSMUSE00000144550 CDS Deleted
ENSMUSE00000509442 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0960_5_C04 PRPGS00148_A_A03 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen - LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 172355 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00148_A_A03 L1L2_Bact_P L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
172355 Knockout First, Reporter-tagged insertion with conditional potential PCS00148_A_A03