IKMC Project Report - EUCOMM (ID: 120137)
0610007P14Rik MGI:1915571 ENSMUSG00000021252 OTTMUSG00000032571
Mice no data available
Mutagenesis Predictions
This gene has 5 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000021676 | protein_coding | Residual N-terminal, novel C-terminal product | view | |||||||||||||||||||||||||||||||
|
Predicted translation: MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLDSITSHCGHSSSPWDTSSQSCLYLEQQLPQLVCWHP *
|
||||||||||||||||||||||||||||||||||
| ENSMUST00000142331 | protein_coding | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||
| ENSMUST00000124311 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||
| ENSMUST00000131681 | processed_transcript | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||
| ENSMUST00000148323 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||
ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | EPD0958_3_B06 | PG00106_Y_1_G09 | 0610007P14Riktm1a(EUCOMM)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0958_3_A08 | PG00106_Y_1_G09 | 0610007P14Riktm2a(EUCOMM)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 87711 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00106_Y_1_G09 | L1L2_Bact_P | L3L4_pD223_DTA_spec | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 87711 | Knockout First, Reporter-tagged insertion with conditional potential | PCS00106_A_A07 |