IKMC Project Report - EUCOMM (ID: 120291)

0610010F05Rik MGI:1918925 ENSMUSG00000042208 OTTMUSG00000005276
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 7 are protein-coding. Following removal of the floxed region, 7 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000043356 protein_coding No protein product (NMD) view

Predicted translation:

MSRGYPENNNFLNNNNQMVLDMILYPLIGIPQTINWETVARLVPGLTPKECVKRFDELKSCGSSPVDNQYNPLMATGEGP
VETLATYIKSSLLDTQGDFQETPVDQDTVSKAGRHSIATTRNCSSESENCTARNAGEETGESEGPNMVIHVCDEAKSLKE
DFICPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYVKRNTKESKDCEIPALEPGNVISILISSEFLKM
DSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001074010 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001026890 CDS CDS
ENSMUSE00001069154 CDS CDS
ENSMUSE00001070576 DUF3342 (77/303 aa) CDS CDS
ENSMUSE00001035094 DUF3342 (20/303 aa) CDS CDS
ENSMUSE00000964412 DUF3342 (54/303 aa) CDS Deleted
ENSMUSE00001042656 DUF3342 (30/303 aa) CDS CDS + stop codon + UTR
ENSMUSE00001003660 DUF3342 (38/303 aa) CDS
ENSMUSE00001080203 DUF3342 (42/303 aa) CDS
ENSMUSE00001057832 DUF3342 (46/303 aa) CDS
ENSMUSE00000986269 CDS
ENSMUSE00000998365 CDS
ENSMUSE00001091425 CDS
ENSMUSE00001001779 CDS
ENSMUSE00000992892 CDS
ENSMUSE00001002889 CDS
ENSMUSE00001051032 CDS
ENSMUSE00001006318 CDS
ENSMUSE00001001582 CDS
ENSMUSE00000103075 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000180260 protein_coding No protein product (NMD) view

Predicted translation:

MSRGYPENNNFLNNNNQMVLDMILYPLIGIPQTINWETVARLVPGLTPKECVKRFDELKSCGSSPVDNQYNPLMATGEGP
VETLATYIKSSLLDTQGDFQETPVDQDTVSKAGRHSIATTRNCSSESENCTARNAGEETGESEGPNMVIHVCDEAKSLKE
DFICPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYVKRNTKESKDCEIPALEPGNVISILISSEFLKM
DSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000680653 UTR UTR
ENSMUSE00000680652 UTR UTR
ENSMUSE00001004715 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001026890 CDS CDS
ENSMUSE00001069154 CDS CDS
ENSMUSE00001070576 DUF3342 (77/303 aa) CDS CDS
ENSMUSE00001035094 DUF3342 (20/303 aa) CDS CDS
ENSMUSE00000964412 DUF3342 (54/303 aa) CDS Deleted
ENSMUSE00001042656 DUF3342 (30/303 aa) CDS CDS + stop codon + UTR
ENSMUSE00001003660 DUF3342 (38/303 aa) CDS
ENSMUSE00001080203 DUF3342 (42/303 aa) CDS
ENSMUSE00001057832 DUF3342 (46/303 aa) CDS
ENSMUSE00000986269 CDS
ENSMUSE00000998365 CDS
ENSMUSE00001091425 CDS
ENSMUSE00001001779 CDS
ENSMUSE00000992892 CDS
ENSMUSE00001002889 CDS
ENSMUSE00001051032 CDS
ENSMUSE00001006318 CDS
ENSMUSE00001001582 CDS
ENSMUSE00000915333 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000109532 protein_coding No protein product (NMD) view

Predicted translation:

MSRGYPENNNFLNNNNQMVLDMILYPLIGIPQTINWETVARLVPGLTPKECVKRFDELKSCGSSPVDNQYNPLMATGEGP
VETLATYIKSSLLDTQGDFQETPVDQDTVSKAGRHSIATTRNCSSESENCTARNAGEETGESEGPNMVIHVCDEAKSLKE
DFICPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYVKRNTKESKDCEIPALEPGNVISILISSEFLKM
DSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000874408 UTR UTR
ENSMUSE00000873209 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001026890 CDS CDS
ENSMUSE00001069154 CDS CDS
ENSMUSE00001070576 DUF3342 (77/303 aa) CDS CDS
ENSMUSE00001035094 DUF3342 (20/303 aa) CDS CDS
ENSMUSE00000964412 DUF3342 (54/303 aa) CDS Deleted
ENSMUSE00001042656 DUF3342 (30/303 aa) CDS CDS + stop codon + UTR
ENSMUSE00001003660 DUF3342 (38/303 aa) CDS
ENSMUSE00001080203 DUF3342 (42/303 aa) CDS
ENSMUSE00001057832 DUF3342 (46/303 aa) CDS
ENSMUSE00000986269 CDS
ENSMUSE00000998365 CDS
ENSMUSE00001091425 CDS
ENSMUSE00001001779 CDS
ENSMUSE00000992892 CDS
ENSMUSE00001002889 CDS
ENSMUSE00001051032 CDS
ENSMUSE00001006318 CDS
ENSMUSE00001001582 CDS
ENSMUSE00000915333 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000093267 protein_coding No protein product (NMD) view

Predicted translation:

MVIHVCDEAKSLKEDFICPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYVKRNTKESKDCEIPALEPG
NVISILISSEFLKMDSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001082357 UTR UTR
ENSMUSE00000997222 UTR UTR
ENSMUSE00000964387 DUF3342 (77/303 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001035094 DUF3342 (20/303 aa) CDS CDS
ENSMUSE00000964412 DUF3342 (54/303 aa) CDS Deleted
ENSMUSE00001042656 DUF3342 (30/303 aa) CDS CDS + stop codon + UTR
ENSMUSE00001003660 DUF3342 (38/303 aa) CDS
ENSMUSE00001080203 DUF3342 (42/303 aa) CDS
ENSMUSE00001057832 DUF3342 (46/303 aa) CDS
ENSMUSE00000986269 CDS
ENSMUSE00000998365 CDS
ENSMUSE00001091425 CDS
ENSMUSE00001001779 CDS
ENSMUSE00000992892 CDS
ENSMUSE00001002889 CDS
ENSMUSE00001051032 CDS
ENSMUSE00001006318 CDS
ENSMUSE00001001582 CDS
ENSMUSE00000680655 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000141353 protein_coding No analysis available: incomplete transcript
ENSMUST00000131612 protein_coding Target region does not overlap transcript
ENSMUST00000123909 protein_coding Target region does not overlap transcript
ENSMUST00000155903 nonsense_mediated_decay No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available