IKMC Project Report - EUCOMM (ID: 120307)

Cd46 MGI:1203290 ENSMUSG00000016493 OTTMUSG00000034956
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000162650 protein_coding No protein product (NMD) view

Predicted translation:

MTAAPLMPDSTHPCRRRKSYTFFWCSLGVYAEALLFLLSHLSDACELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLY
LSPYLMIATCEPNHTWVPISDAGCIIIT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000341749 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000326998 Sushi_SCR_CCP (54/54 aa) CDS CDS
ENSMUSE00000326992 Sushi_SCR_CCP (31/60 aa) CDS Deleted
ENSMUSE00000161142 Sushi_SCR_CCP (30/60 aa) CDS CDS + stop codon + UTR
ENSMUSE00000161147 Sushi_SCR_CCP (62/62 aa) CDS
ENSMUSE00000970020 Sushi_SCR_CCP (56/56 aa) CDS
ENSMUSE00001020545 CDS
ENSMUSE00001052028 CDS
ENSMUSE00001078186 CDS
ENSMUSE00001048869 CDS
ENSMUSE00000871805 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000160817 protein_coding No protein product (NMD) view

Predicted translation:

MTAAPLMPDSTHPCRRRKSYTFFWCSLGVYAEALLFLLSHLSDACELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLY
LSPYLMIATCEPNHTWVPISDAGCIIIT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000341749 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000326998 Sushi_SCR_CCP (54/54 aa) CDS CDS
ENSMUSE00000326992 Sushi_SCR_CCP (31/60 aa) CDS Deleted
ENSMUSE00000161142 Sushi_SCR_CCP (30/60 aa) CDS CDS + stop codon + UTR
ENSMUSE00000161147 Sushi_SCR_CCP (62/62 aa) CDS
ENSMUSE00000970020 Sushi_SCR_CCP (56/56 aa) CDS
ENSMUSE00001052028 CDS
ENSMUSE00001078186 CDS
ENSMUSE00001048869 CDS
ENSMUSE00000865481 CDS + stop codon + UTR
ENSMUSE00000861194 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000016637 protein_coding No protein product (NMD) view

Predicted translation:

MTAAPLMPDSTHPCRRRKSYTFFWCSLGVYAEALLFLLSHLSDACELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLY
LSPYLMIATCEPNHTWVPISDAGCIIIT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000341749 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000326998 Sushi_SCR_CCP (54/54 aa) CDS CDS
ENSMUSE00000326992 Sushi_SCR_CCP (31/60 aa) CDS Deleted
ENSMUSE00000161142 Sushi_SCR_CCP (30/60 aa) CDS CDS + stop codon + UTR
ENSMUSE00000161147 Sushi_SCR_CCP (62/62 aa) CDS
ENSMUSE00000970020 Sushi_SCR_CCP (56/56 aa) CDS
ENSMUSE00001052028 CDS
ENSMUSE00001078186 CDS
ENSMUSE00001048869 CDS
ENSMUSE00001068602 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000162614 protein_coding No protein product (NMD) view

Predicted translation:

MTAAPLMPDSTHPCRRRKSYTFFWCSLGVYAEALLFLLSHLSDACELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLY
LSPYLMIATCEPNHTWVPISDAGCIIIT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000341749 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000326998 Sushi_SCR_CCP (54/54 aa) CDS CDS
ENSMUSE00000326992 Sushi_SCR_CCP (31/60 aa) CDS Deleted
ENSMUSE00000161142 Sushi_SCR_CCP (30/60 aa) CDS CDS + stop codon + UTR
ENSMUSE00000161147 Sushi_SCR_CCP (62/62 aa) CDS
ENSMUSE00001052028 CDS
ENSMUSE00001078186 CDS
ENSMUSE00001048869 CDS
ENSMUSE00000854731 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000159563 nonsense_mediated_decay No protein product (NMD) view

Predicted translation:

MTAAPLMPDSTHPCRRRKSYTFFWCSLGVYAEALLFLLSHLSDACELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLY
LSPYLMIATCEPNHTWVPISDAGCIIIT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000341749 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000326998 Sushi_SCR_CCP (54/54 aa) CDS CDS
ENSMUSE00000326992 Sushi_SCR_CCP (31/60 aa) CDS Deleted
ENSMUSE00000161142 Sushi_SCR_CCP (30/60 aa) CDS CDS + stop codon + UTR
ENSMUSE00000161147 Sushi_SCR_CCP (62/62 aa) CDS
ENSMUSE00000970020 Sushi_SCR_CCP (56/56 aa) CDS
ENSMUSE00000861176 CDS + stop codon + UTR
ENSMUSE00001028937 UTR UTR
ENSMUSE00001024319 UTR UTR
ENSMUSE00001089362 UTR UTR
ENSMUSE00001053941 UTR UTR
ENSMUSE00001075420 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000161772 retained_intron Target region does not overlap transcript
ENSMUST00000162951 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available