IKMC Project Report - EUCOMM (ID: 121443)

1110017D15Rik MGI:1920971 ENSMUSG00000028441 OTTMUSG00000006656
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000030152 protein_coding No protein product (NMD) view

Predicted translation: 

MFLFSRKTKTPISTYSDSYRAPTSIKEVYKDPPLWAWEANKFVTPRTNAVRATWTMTGTTRGRRVLAATTGTSIPAVFLD
CPRTPGWSQFEECRWNILLSRSASTPTSAR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000675377 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000982167 CDS Deleted
ENSMUSE00001042921 CDS CDS
ENSMUSE00001031042 CDS CDS
ENSMUSE00001042812 CDS CDS + stop codon + UTR
ENSMUSE00001094683 CDS + stop codon + UTR
ENSMUSE00001052487 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000095126 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MFLFSRKTKTPISTYSDSYRAPTSIKEVYKDPPLWAWEANKFVTPRTNAVRATWTMTGTTRGRRVLAATTGTSIPAVFLD
CPRTPGWSQFEECRWNILLSRSASTPTECVALRSPARNAMCCYNSPAIILPVSQP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000675377 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000982167 CDS Deleted
ENSMUSE00001042921 CDS CDS
ENSMUSE00001031042 CDS CDS
ENSMUSE00000972033 CDS CDS
ENSMUSE00001060909 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000125303 protein_coding No analysis available: incomplete transcript
ENSMUST00000134546 processed_transcript No analysis available: incomplete transcript
ENSMUST00000124019 processed_transcript Target region does not overlap transcript
ENSMUST00000123356 processed_transcript Target region does not overlap transcript
ENSMUST00000123865 processed_transcript Target region does not overlap transcript
ENSMUST00000138217 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 385662 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00256_Y_7_D06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view

Intermediate Vectors no data available