IKMC Project Report - KOMP-CSD (ID: 22689)

Unc80 MGI:2652882 ENSMUSG00000055567 OTTMUSG00000026091
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000061620 protein_coding No protein product (NMD) view

Predicted translation: 

MVKRKSSEGQEQDGGRGIPLPIQTFLWRQTSAFLRPKLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRWELVQA
ALPHVLHCTATLLSNRNKLGI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000697759 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000998174 CDS CDS
ENSMUSE00000977736 CDS CDS
ENSMUSE00000997337 CDS Deleted
ENSMUSE00000980773 CDS CDS + stop codon + UTR
ENSMUSE00000411642 CDS
ENSMUSE00000368618 CDS
ENSMUSE00001004738 CDS
ENSMUSE00000348503 CDS
ENSMUSE00000697756 CDS
ENSMUSE00000697755 CDS
ENSMUSE00000697754 CDS
ENSMUSE00000697752 CDS
ENSMUSE00000697751 CDS
ENSMUSE00000697750 CDS
ENSMUSE00000697749 CDS
ENSMUSE00000697748 CDS
ENSMUSE00000697747 CDS
ENSMUSE00000891077 CDS
ENSMUSE00000697745 CDS
ENSMUSE00000697743 CDS
ENSMUSE00000697742 CDS
ENSMUSE00000697739 CDS
ENSMUSE00000697738 CDS
ENSMUSE00000697736 CDS
ENSMUSE00000697735 CDS
ENSMUSE00000895037 CDS
ENSMUSE00000697734 CDS
ENSMUSE00000697733 CDS
ENSMUSE00000697732 CDS
ENSMUSE00000697731 CDS
ENSMUSE00000697730 CDS
ENSMUSE00000697728 CDS
ENSMUSE00000697726 CDS
ENSMUSE00000697703 CDS
ENSMUSE00000544983 CDS
ENSMUSE00000455058 CDS
ENSMUSE00000544982 CDS
ENSMUSE00000154860 CDS
ENSMUSE00000154871 CDS
ENSMUSE00000154845 CDS
ENSMUSE00000154873 CDS
ENSMUSE00000154848 CDS
ENSMUSE00000154874 CDS
ENSMUSE00000544981 CDS
ENSMUSE00000154875 CDS
ENSMUSE00000154864 CDS
ENSMUSE00000336771 CDS
ENSMUSE00000544979 CDS
ENSMUSE00000544978 CDS
ENSMUSE00000544977 CDS
ENSMUSE00000544975 CDS
ENSMUSE00000544974 CDS
ENSMUSE00000544973 CDS
ENSMUSE00000544972 CDS
ENSMUSE00000544970 CDS
ENSMUSE00000544967 CDS
ENSMUSE00000544965 CDS
ENSMUSE00000544963 CDS
ENSMUSE00000344460 CDS
ENSMUSE00000544956 CDS
ENSMUSE00000392699 CDS
ENSMUSE00000346835 CDS
ENSMUSE00000401095 CDS
ENSMUSE00000826861 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000152844 protein_coding Target region does not overlap transcript
ENSMUST00000114008 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000136727 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0672_2_A06 PG00089_Y_3_B02 Unc80tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR fail 5' SR-PCR - 3' SR-PCR fail
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0672_2_A06 PG00089_Y_3_B02 Unc80tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA fail LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b fail Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0672_2_A05 PG00089_Y_3_B02 Unc80tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR fail 5' SR-PCR - 3' SR-PCR fail
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0672_2_B05 PG00089_Y_3_B02 Unc80tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0672_2_A07 PG00089_Y_3_B02 Unc80tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 50965 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00089_Y_1_B02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 50965 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00089_Y_3_C02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 50965 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00089_A_C02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 50965 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00089_Y_3_B02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
50965 Knockout First, Reporter-tagged insertion with conditional potential PCS00089_A_C02
50965 Knockout First, Reporter-tagged insertion with conditional potential PCS00089_B_C02