IKMC Project Report - KOMP-CSD (ID: 23199)

Rabl6 MGI:2442633 ENSMUSG00000015087 OTTMUSG00000012248
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 9 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000058137 protein_coding No protein product (NMD) view

Predicted translation:

MFSALKKLVGSEQAPGRDKNIPAGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGKKFVEEYIPTQEIQV
TSIHWNYKTTDDVVKVEVWDVVDKGRV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000839811 Small_GTPase_ARF/SAR (5/67 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000998923 Small_GTPase (44/56 aa) | MIRO-like (44/135 aa) | Small_GTPase_ARF/SAR (46/67 aa) CDS CDS
ENSMUSE00001061929 Small_GTPase (13/56 aa) | MIRO-like (17/135 aa) | Small_GTPase_ARF/SAR (17/67 aa) CDS CDS
ENSMUSE00001077575 MIRO-like (18/135 aa) | Small_GTPase_ARF/SAR (2/67 aa) CDS Deleted
ENSMUSE00000991984 MIRO-like (31/135 aa) CDS CDS + stop codon + UTR
ENSMUSE00001067647 MIRO-like (28/135 aa) CDS
ENSMUSE00001067044 CDS
ENSMUSE00001014100 CDS
ENSMUSE00000971624 CDS
ENSMUSE00001060033 CDS
ENSMUSE00001015447 CDS
ENSMUSE00001084054 CDS
ENSMUSE00001075698 CDS
ENSMUSE00000416090 CDS
ENSMUSE00000569209 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000150206 processed_transcript Target region does not overlap transcript
ENSMUST00000146012 processed_transcript No analysis available: incomplete transcript
ENSMUST00000140635 processed_transcript No analysis available: incomplete transcript
ENSMUST00000140778 processed_transcript Target region does not overlap transcript
ENSMUST00000140785 processed_transcript No analysis available: incomplete transcript
ENSMUST00000143855 processed_transcript Target region does not overlap transcript
ENSMUST00000135084 processed_transcript Target region does not overlap transcript
ENSMUST00000128942 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 34152 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00052_A_G03 L1L2_gt1 L3L4_pZero_DTA_kan view
order 34152 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00052_A_6_G03 L1L2_gt1 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
34152 Knockout First, Reporter-tagged insertion with conditional potential PCS00052_A_G03