IKMC Project Report - KOMP-CSD (ID: 23300)

1110012L19Rik MGI:1915868 ENSMUSG00000045237 OTTMUSG00000017762
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000053981 protein_coding Novel (out of frame) product view

Predicted translation: 

MKGMAVNTSLMLWRCQQNYRALRTLTFREKETSQEMIFA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000349216 UTR UTR
ENSMUSE00000376516 ASCH_domain (79/87 aa) UTR + start codon + CDS Deleted
ENSMUSE00000346578 ASCH_domain (9/87 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 44265 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00049_B_G03 L1L2_gt0 L3L4_pZero_DTA_kan view
order 44265 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00049_A_G03 L1L2_gt0 L3L4_pZero_DTA_kan view
order 44265 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00049_A_4_G03 L1L2_gt0 L3L4_pZero_DTA_kan view
order 44265 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00049_A_8_F03 L1L2_gt0 L3L4_pZero_DTA_kan view
order 44265 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00049_A_4_H03 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
44265 Knockout First, Reporter-tagged insertion with conditional potential PCS00049_A_G03