IKMC Project Report - EUCOMM (ID: 23501)

Aspm MGI:1334448 ENSMUSG00000033952 OTTMUSG00000019630
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000053364 protein_coding No protein product (NMD) view

Predicted translation:

MATMQAASCPEERGRRARPDPEAGDPSPPVLLLSHFCGVPFLCFGDVRVGTSRTRSLVLHNPHEEPLQVELSLLRAAGQG
FSVAPNRCELKPKEKLTISVTWTPLREGGVREIVTFLVNDFLKHQAILLGNAEEPKKKKRSLWNTSKKIPASSKHTKRTS
KNQHFNESFTISQKDRIRSPLQPCENLAMSECSSPTENKVPTPSISPIRECQSETCLPLFLRESTAYSSLHESENTQNLK
VQDASISQTFDFNEEVANETFINPISVCHQSEGDRKLTLAPNCSSPLNSTQTQIHFLSPDSFVNNRYTSDNDLKSMKNVL
SDTFRKDPAESVCLESQTVHEVCQTILSPDSFLNDNYGLKKGLNFKSVNPVLSPTQFVKDSMGHVGQQTGKSNEASQDWR
INEGLAYTPECQHAQTPSSRSEKQNPVEVKPHTYDFTKQKPKISEFQDAFCHQSKQPHKRRPILSATVTKRKPTNAREKL
PEINKPDAKRCLEGLVGERGKEVGSLREKGFHSSLPVVEPGVSKALSYRDEVTPATVVVARKRKSHGTVGDANGKVAAEE
WMDMCEVKRIHFSPLESTPSTVARTTKKEGHTSKRISSLERSGLKKKMDSSILKTPLSKTKKKRRSIVAVAQSHLTFIKP
LKAAIPRHPMPFAAKNMFYDERWKEKQEQGFTWWLNYILTPDDFTVKTNVSKVNAASLVLGAESQHKISVPKAPTKEEVS
LRAYTASCRLNRLRRTACSLFTSEKMVKAIKKVEIEIEVGRLLVRKDRHLWKDIDSFWRTDPSGRQQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000790543 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001024383 CDS CDS
ENSMUSE00000997937 CDS CDS
ENSMUSE00001055713 CDS CDS
ENSMUSE00001006863 CDS CDS
ENSMUSE00001034132 CDS CDS
ENSMUSE00001033684 CDS Deleted
ENSMUSE00001014855 CDS CDS + stop codon + UTR
ENSMUSE00001020542 CDS
ENSMUSE00000978590 CDS
ENSMUSE00000386272 CDS
ENSMUSE00000351105 CDS
ENSMUSE00001004118 CAMSAP_CH (11/77 aa) | CH-domain (16/86 aa) CDS
ENSMUSE00000975734 CAMSAP_CH (66/77 aa) | CH-domain (70/86 aa) CDS
ENSMUSE00001040946 CH-domain (1/86 aa) CDS
ENSMUSE00000352077 CDS
ENSMUSE00000376583 IQ_motif_EF-hand-BS (7/20 aa) CDS
ENSMUSE00000462716 IQ_motif_EF-hand-BS (13/20 aa) | IQ_motif_EF-hand-BS (17/17 aa) | IQ_motif_EF-hand-BS (19/19 aa) | IQ_motif_EF-hand-BS (20/20 aa) | IQ_motif_EF-hand-BS (21/21 aa) | IQ_motif_EF-hand-BS (21/21 aa) | IQ_motif_EF-hand-BS (20/20 aa) | IQ_motif_EF-hand-BS (21/21 aa) | IQ_motif_EF-hand-BS (19/19 aa) | IQ_motif_EF-hand-BS (20/20 aa) | IQ_motif_EF-hand-BS (19/19 aa) | IQ_motif_EF-hand-BS (21/21 aa) | IQ_motif_EF-hand-BS (21/21 aa) | IQ_motif_EF-hand-BS (19/19 aa) | IQ_motif_EF-hand-BS (18/18 aa) | IQ_motif_EF-hand-BS (20/20 aa) | IQ_motif_EF-hand-BS (18/18 aa) | IQ_motif_EF-hand-BS (21/21 aa) | IQ_motif_EF-hand-BS (18/18 aa) | IQ_motif_EF-hand-BS (20/20 aa) | IQ_motif_EF-hand-BS (21/21 aa) | IQ_motif_EF-hand-BS (20/20 aa) | IQ_motif_EF-hand-BS (20/20 aa) | IQ_motif_EF-hand-BS (20/20 aa) | IQ_motif_EF-hand-BS (20/20 aa) | IQ_motif_EF-hand-BS (18/18 aa) CDS
ENSMUSE00000375010 IQ_motif_EF-hand-BS (19/19 aa) CDS
ENSMUSE00000379412 CDS
ENSMUSE00000340643 IQ_motif_EF-hand-BS (20/20 aa) | IQ_motif_EF-hand-BS (17/18 aa) CDS
ENSMUSE00000382766 IQ_motif_EF-hand-BS (1/18 aa) | IQ_motif_EF-hand-BS (6/19 aa) CDS
ENSMUSE00000485201 IQ_motif_EF-hand-BS (13/19 aa) | IQ_motif_EF-hand-BS (6/18 aa) CDS
ENSMUSE00000494811 IQ_motif_EF-hand-BS (12/18 aa) CDS
ENSMUSE00000368705 CDS
ENSMUSE00000407660 CDS
ENSMUSE00000402082 CDS
ENSMUSE00000800158 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000097554 protein_coding No protein product (NMD) view

Predicted translation:

MATMQAASCPEERGRRARPDPEAGDPSPPVLLLSHFCGVPFLCFGDVRVGTSRTRSLVLHNPHEEPLQVELSLLRAAGQG
FSVAPNRCELKPKEKLTISVTWTPLREGGVREIVTFLVNDFLKHQAILLGNAEEPKKKKRSLWNTSKKIPASSKHTKRTS
KNQHFNESFTISQKDRIRSPLQPCENLAMSECSSPTENKVPTPSISPIRECQSETCLPLFLRESTAYSSLHESENTQNLK
VQDASISQTFDFNEEVANETFINPISVCHQSEGDRKLTLAPNCSSPLNSTQTQIHFLSPDSFVNNRYTSDNDLKSMKNVL
SDTFRKDPAESVCLESQTVHEVCQTILSPDSFLNDNYGLKKGLNFKSVNPVLSPTQFVKDSMGHVGQQTGKSNEASQDWR
INEGLAYTPECQHAQTPSSRSEKQNPVEVKPHTYDFTKQKPKISEFQDAFCHQSKQPHKRRPILSATVTKRKPTNAREKL
PEINKPDAKRCLEGLVGERGKEVGSLREKGFHSSLPVVEPGVSKALSYRDEVTPATVVVARKRKSHGTVGDANGKVAAEE
WMDMCEVKRIHFSPLESTPSTVARTTKKEGHTSKRISSLERSGLKKKMDSSILKTPLSKTKKKRRSIVAVAQSHLTFIKP
LKAAIPRHPMPFAAKNMFYDERWKEKQEQGFTWWLNYILTPDDFTVKTNVSKVNAASLVLGAESQHKISVPKAPTKEEVS
LRAYTASCRLNRLRRTACSLFTSEKMVKAIKKVEIEIEVGRLLVRKDRHLWKDIDSFWRTDPSGRQQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000790543 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001024383 CDS CDS
ENSMUSE00000997937 CDS CDS
ENSMUSE00001055713 CDS CDS
ENSMUSE00001006863 CDS CDS
ENSMUSE00001034132 CDS CDS
ENSMUSE00001033684 CDS Deleted
ENSMUSE00001014855 CDS CDS + stop codon + UTR
ENSMUSE00001020542 CDS
ENSMUSE00000978590 CDS
ENSMUSE00000386272 CDS
ENSMUSE00000351105 CDS
ENSMUSE00001004118 CAMSAP_CH (11/77 aa) | CH-domain (16/86 aa) CDS
ENSMUSE00000975734 CAMSAP_CH (66/77 aa) | CH-domain (70/86 aa) CDS
ENSMUSE00001040946 CH-domain (1/86 aa) CDS
ENSMUSE00000352077 CDS
ENSMUSE00000376583 IQ_motif_EF-hand-BS (7/19 aa) CDS
ENSMUSE00000375010 IQ_motif_EF-hand-BS (12/19 aa) | IQ_motif_EF-hand-BS (19/19 aa) CDS
ENSMUSE00000379412 CDS
ENSMUSE00000340643 IQ_motif_EF-hand-BS (20/20 aa) | IQ_motif_EF-hand-BS (17/18 aa) CDS
ENSMUSE00000382766 IQ_motif_EF-hand-BS (1/18 aa) | IQ_motif_EF-hand-BS (6/19 aa) CDS
ENSMUSE00000485201 IQ_motif_EF-hand-BS (13/19 aa) | IQ_motif_EF-hand-BS (18/18 aa) | IQ_motif_EF-hand-BS (6/18 aa) CDS
ENSMUSE00000494811 IQ_motif_EF-hand-BS (12/18 aa) CDS
ENSMUSE00000368705 CDS
ENSMUSE00000407660 CDS
ENSMUSE00000402082 CDS
ENSMUSE00000739690 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000155402 retained_intron No analysis available: incomplete transcript
ENSMUST00000128413 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available