IKMC Project Report - KOMP-CSD (ID: 23595)

Tjp1 MGI:98759 ENSMUSG00000030516 OTTMUSG00000016466
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Genotype confirmed

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
currently unavailable Genotype confirmed Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) EPD0494_2_H09 C57BL/6NTac;C57BL/6NTac;C57BL/6N-Atm1Brd/a view
( about ) 		UCD/
Southern Blot na TV Backbone Assay na 5' LR-PCR pass
Loss of WT Allele (LOA) qPCR na Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR na 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR na LoxP Confirmation na 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000102592 protein_coding Residual C-terminal product view

Predicted translation: 

MVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSHPDPEPVSDNEDDSYDEEVHDPRAGRGALANRRSEKSWA
RDRSASRERSLSPRSDRRSVASSQPAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTV
TENMSLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSGRSHDRPPRRSQSRSP
DQRSEPSDHSTQSPQQPSNGSLRSREEERMSKPGAISTPVKHVDDHPPKAVEEVTVEKNEKQTPTLPEPKPVYAQVGQPD
VDLPVSPSDGALPNSAHEDGILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFT
NIIREEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGS
WLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERV
VLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIAKSEPRDAGTDHRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRL
NYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQ
LVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITR
SSEPVREDSSGMHHENQTYPPYSPQAQPQAIHRIDSPGLKPASQQKAEASSPVPYLSPETTPASSASAVNHNVSVTNVSL
EEPAPAPPTSHASQPGCLGAPSAEAAHVVLRGEGPPLPPHADPAKVYRKEPYSEEMMRQNHILKQPALGHPGQRPDKEPN
LAYEPQLPYIEKQASRDLEQPSYRYEVSSYTDQFSRNYDHRLRFEDRIPTYEDQWSYYDDKQPYQPRPFENQHPRDLDSR
QHPEEASERGYFQRFEEPAPLSYDSRTRYEQLPRTSTLRHEEQPAPAYEVHNRYRPEAQPYSSTGPKSSEPKQYFDQYPR
SYEQVPPPGFTSKTGHYEPLHGAAVVPPLIPSSQQKPEVLPSATKPQPPPPTLTEEEEDPAMKPQSVLTRVKMFENKRSA
SLENKKDVNDTASFKPPEVASKPPGASLAGPKPVPQSQFSEHDKTLYRLPEPQKPQVKPPEDIVRSNHYDPEEDEEYYRK
QLSYFDRRSFESKPSAHLPAGHHSEPAKPVHSQSQPNFSSYSSKGKPETDAVDRSFSEKRYDPAQATPPPPPLPSQYSQP
APPLSSSSLHIHSKGAQGEGNSVSLDFQNSYMSKPDPPPSQSKPATFRPPTREDPPQTFYPQKSFPDKAPVNGAEQTQKT
ITPVYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETVHKPELSSKTPTSPKTLMKAHSSTQPPEFDSGVETFSVHTDK
PKYQMNNISTMPKAVPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDN
SILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000662032 UTR + start codon + CDS
ENSMUSE00000662031 PDZ (4/83 aa) CDS
ENSMUSE00000200040 PDZ (42/83 aa) CDS Deleted
ENSMUSE00000200034 PDZ (35/83 aa) CDS UTR + start codon + CDS
ENSMUSE00000277209 PDZ (3/83 aa) | PDZ (10/75 aa) CDS CDS
ENSMUSE00000277203 PDZ (35/75 aa) CDS CDS
ENSMUSE00000200043 PDZ (31/75 aa) CDS CDS
ENSMUSE00000277194 CDS CDS
ENSMUSE00000277188 CDS CDS
ENSMUSE00000277183 CDS CDS
ENSMUSE00000277179 PDZ (42/73 aa) CDS CDS
ENSMUSE00000277174 PDZ (31/73 aa) CDS CDS
ENSMUSE00000200032 SH3_2 (59/63 aa) CDS CDS
ENSMUSE00000200042 SH3_2 (5/63 aa) CDS CDS
ENSMUSE00000200031 CDS CDS
ENSMUSE00000277146 Guanylate_kin (8/101 aa) CDS CDS
ENSMUSE00000200038 Guanylate_kin (71/101 aa) CDS CDS
ENSMUSE00000200041 Guanylate_kin (23/101 aa) CDS CDS
ENSMUSE00000277133 CDS CDS
ENSMUSE00000277122 CDS CDS
ENSMUSE00000277114 CDS CDS
ENSMUSE00000277104 CDS CDS
ENSMUSE00000277095 CDS CDS
ENSMUSE00000277086 CDS CDS
ENSMUSE00000277078 CDS CDS
ENSMUSE00001001780 ZU5 (56/90 aa) CDS CDS
ENSMUSE00000277062 ZU5 (29/90 aa) CDS CDS
ENSMUSE00000732803 ZU5 (7/90 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000032729 protein_coding Residual C-terminal product view

Predicted translation: 

MVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSHPDPEPVSDNEDDSYDEEVHDPRAGRGALANRRSEKSWA
RDRSASRERSLSPRSDRRSVASSQPAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTV
TENMSLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSGRSHDRPPRRSQSRSP
DQRSEPSDHSTQSPQQPSNGSLRSREEERMSKPGAISTPVKHVDDHPPKAVEEVTVEKNEKQTPTLPEPKPVYAQVGQPD
VDLPVSPSDGALPNSAHEDGILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFT
NIIREEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGS
WLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERV
VLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIAKSEPRDAGTDHRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRL
NYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQ
LVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITR
SSEPVREDSSGMHHENQTYPPYSPQAQPQAIHRIDSPGLKPASQQVYRKEPYSEEMMRQNHILKQPALGHPGQRPDKEPN
LAYEPQLPYIEKQASRDLEQPSYRYEVSSYTDQFSRNYDHRLRFEDRIPTYEDQWSYYDDKQPYQPRPFENQHPRDLDSR
QHPEEASERGYFQRFEEPAPLSYDSRTRYEQLPRTSTLRHEEQPAPAYEVHNRYRPEAQPYSSTGPKSSEPKQYFDQYPR
SYEQVPPPGFTSKTGHYEPLHGAAVVPPLIPSSQQKPEVLPSATKPQPPPPTLTEEEEDPAMKPQSVLTRVKMFENKRSA
SLENKKDVNDTASFKPPEVASKPPGASLAGPKPVPQSQFSEHDKTLYRLPEPQKPQVKPPEDIVRSNHYDPEEDEEYYRK
QLSYFDRRSFESKPSAHLPAGHHSEPAKPVHSQSQPNFSSYSSKGKPETDAVDRSFSEKRYDPAQATPPPPPLPSQYSQP
APPLSSSSLHIHSKGAQGEGNSVSLDFQNSYMSKPDPPPSQSKPATFRPPTREDPPQTFYPQKSFPDKAPVNGAEQTQKT
ITPVYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETVHKPELSSKTPTSPKTLMKAHSSTQPPEFDSGVETFSVHTDK
PKYQMNNISTMPKAVPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDN
SILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGAN
CVSVLIDHF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000912352 UTR + start codon + CDS
ENSMUSE00000662031 PDZ (4/83 aa) CDS
ENSMUSE00000200040 PDZ (42/83 aa) CDS Deleted
ENSMUSE00000200034 PDZ (35/83 aa) CDS UTR + start codon + CDS
ENSMUSE00000277209 PDZ (3/83 aa) | PDZ (10/75 aa) CDS CDS
ENSMUSE00000277203 PDZ (35/75 aa) CDS CDS
ENSMUSE00000200043 PDZ (31/75 aa) CDS CDS
ENSMUSE00000277194 CDS CDS
ENSMUSE00000277188 CDS CDS
ENSMUSE00000277183 CDS CDS
ENSMUSE00000277179 PDZ (42/73 aa) CDS CDS
ENSMUSE00000277174 PDZ (31/73 aa) CDS CDS
ENSMUSE00000200032 SH3_2 (59/63 aa) CDS CDS
ENSMUSE00000200042 SH3_2 (5/63 aa) CDS CDS
ENSMUSE00000200031 CDS CDS
ENSMUSE00000277146 Guanylate_kin (8/101 aa) CDS CDS
ENSMUSE00000200038 Guanylate_kin (71/101 aa) CDS CDS
ENSMUSE00000200041 Guanylate_kin (23/101 aa) CDS CDS
ENSMUSE00000277133 CDS CDS
ENSMUSE00000277114 CDS CDS
ENSMUSE00000277104 CDS CDS
ENSMUSE00000277095 CDS CDS
ENSMUSE00000277086 CDS CDS
ENSMUSE00000277078 CDS CDS
ENSMUSE00001001780 ZU5 (56/102 aa) CDS CDS
ENSMUSE00001079985 ZU5 (47/102 aa) CDS CDS
ENSMUSE00000662030 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000132036 processed_transcript Target region does not overlap transcript
ENSMUST00000144961 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0494_2_H09 PG00023_E_4_F08 Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype 0.8 - 0.71 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_D11 PG00023_E_4_F08 Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.9 - 0.81 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_F09 PG00023_E_4_F08 Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.6 - 0.51 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_E09 PG00023_E_4_F08 Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype 0.9 - 0.81 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_A09 PG00023_E_4_F08 Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_A11 PG00023_E_4_F08 Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_B09 PG00023_E_4_F08 Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_C09 PG00023_E_4_F08 Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_E11 PG00023_E_4_F08 Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_G09 PG00023_E_4_F08 Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_G10 PG00023_E_4_F08 Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_H10 PG00023_E_4_F08 Tjp1tm2a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0494_2_A10 PG00023_E_4_F08 Tjp1tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_B11 PG00023_E_4_F08 Tjp1tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_C10 PG00023_E_4_F08 Tjp1tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_C12 PG00023_E_4_F08 Tjp1tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_D09 PG00023_E_4_F08 Tjp1tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_D12 PG00023_E_4_F08 Tjp1tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_F10 PG00023_E_4_F08 Tjp1tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_F11 PG00023_E_4_F08 Tjp1tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_F12 PG00023_E_4_F08 Tjp1tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_H11 PG00023_E_4_F08 Tjp1tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0494_2_H12 PG00023_E_4_F08 Tjp1tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 37410 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_E_4_F08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37410 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_E_3_F08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37410 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_D_1_F08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37410 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00023_E_F08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37410 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_E_2_F08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37410 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_D_2_F08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37410 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_E_1_F08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37410 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00023_A_F08 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
37410 Knockout First, Reporter-tagged insertion with conditional potential PCS00023_E_F08