IKMC Project Report - EUCOMM (ID: 23622)

Inip MGI:1913459 ENSMUSG00000038544 OTTMUSG00000007409
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000095063 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAANPSGQASRSPDPLLPRTSGTMLSSSTSLPSRRQLCSMLTHIPLATS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000604185 UTR UTR
ENSMUSE00001089806 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001022638 CDS Deleted
ENSMUSE00000322503 CDS CDS
ENSMUSE00000604184 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000107526 protein_coding Novel (out of frame) product view

Predicted translation: 

MWEALGLTPSLHIQALRMAHACDLSTRGIEAEDWKFKAILA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000673453 UTR UTR
ENSMUSE00001033737 UTR + start codon + CDS Deleted
ENSMUSE00000322503 CDS
ENSMUSE00000673451 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000143756 protein_coding No protein product
ENSMUST00000128548 processed_transcript No analysis available: incomplete transcript
ENSMUST00000138097 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 415 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00017_A_A10 L1L2_gt1 L3L4_pZero_DTA_kan view
order 415 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00017_B_3_A10 L1L2_gt1 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
415 Knockout First, Reporter-tagged insertion with conditional potential PCS00017_A_A10