IKMC Project Report - KOMP-CSD (ID: 23633)

Ephx4 MGI:2686228 ENSMUSG00000033805 OTTMUSG00000023959
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000049146 protein_coding No protein product (NMD) view

Predicted translation: 

MAPPRPPRLLPALRALLYWSLVYGYCGLCASVHLLKLLWSIGRAPAQTFRRAARANPPACLNDPSLGTHCYVRIKDSGLR
FHYVAAGERGKPLMLLLHGFPEF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000378200 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000992282 CDS CDS
ENSMUSE00000304384 AB_hydrolase_1 (39/232 aa) CDS Deleted
ENSMUSE00000304376 AB_hydrolase_1 (44/232 aa) CDS Deleted
ENSMUSE00000390078 AB_hydrolase_1 (35/232 aa) CDS CDS + stop codon + UTR
ENSMUSE00000347550 AB_hydrolase_1 (50/232 aa) CDS
ENSMUSE00000390932 AB_hydrolase_1 (67/232 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000159968 protein_coding No analysis available: incomplete transcript
ENSMUST00000161452 protein_coding No analysis available: incomplete transcript
ENSMUST00000161246 protein_coding No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 42488 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00036_W_3_H12 L1L2_Bact_P R3R4_pBR_amp view
order 42488 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00036_W_5_H12 L1L2_Bact_P R3R4_pBR_amp view
order 42488 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00036_W_1_H12 L1L2_Bact_P R3R4_pBR_amp view
order 42488 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00036_W_7_H12 L1L2_Bact_P R3R4_pBR_amp view
order 42488 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00036_W_8_H12 L1L2_Bact_P R3R4_pBR_amp view
order 42488 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00036_B_H12 L1L2_Bact_P R3R4_pBR_amp view
order 42488 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00036_W_6_H12 L1L2_Bact_P R3R4_pBR_amp view
order 42488 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00036_W_2_H12 L1L2_Bact_P R3R4_pBR_amp view
order 42488 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00036_W_6_G05 L1L2_Bact_P R3R4_pBR_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
42488 Knockout-First - Reporter Tagged Insertion PCS00036_A_H12