IKMC Project Report - KOMP-CSD (ID: 23936)

Stmn4 MGI:1931224 ENSMUSG00000022044 OTTMUSG00000027814
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 9 wild type transcripts, of which 6 are protein-coding. Following removal of the floxed region, 6 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000074523 protein_coding No protein product (NMD) view

Predicted translation:

MTLAAYKEKMKELPLVSLFCSCFLSDPLNKSSYKYEVPGS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000810750 UTR UTR
ENSMUSE00001022272 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001068718 CDS CDS
ENSMUSE00000999852 Stathmin (58/140 aa) CDS Deleted
ENSMUSE00000123188 Stathmin (64/140 aa) CDS CDS + stop codon + UTR
ENSMUSE00000352145 Stathmin (18/140 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000120229 protein_coding No protein product (NMD) view

Predicted translation:

MTLAAYKEKMKELPLVSLFCSCFLSDPLNKSSYKYEVPGS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000268156 UTR UTR
ENSMUSE00001022272 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001068718 CDS CDS
ENSMUSE00000710843 CDS Deleted
ENSMUSE00000999852 Stathmin (58/140 aa) CDS Deleted
ENSMUSE00000123188 Stathmin (64/140 aa) CDS CDS + stop codon + UTR
ENSMUSE00000716258 Stathmin (18/140 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000121955 protein_coding No protein product (NMD) view

Predicted translation:

MTLAAYKEKMKELPLVSLFCSCFLSDPLNKSSYKYEVPGS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000721692 UTR UTR
ENSMUSE00001022272 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001068718 CDS CDS
ENSMUSE00000710843 CDS Deleted
ENSMUSE00000999852 Stathmin (58/125 aa) CDS Deleted
ENSMUSE00000123188 Stathmin (64/125 aa) CDS CDS + stop codon + UTR
ENSMUSE00000708908 Stathmin (3/125 aa) CDS + stop codon + UTR
ENSMUSE00000715991 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000118426 protein_coding No protein product (NMD) view

Predicted translation:

MTLAAYKEKMKELPLVSLFCSCFLSDPLNKSSYKYEVPGS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000709604 UTR UTR
ENSMUSE00001022272 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001068718 CDS CDS
ENSMUSE00000999852 Stathmin (58/125 aa) CDS Deleted
ENSMUSE00000123188 Stathmin (64/125 aa) CDS CDS + stop codon + UTR
ENSMUSE00000708908 Stathmin (3/125 aa) CDS + stop codon + UTR
ENSMUSE00000715991 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000134440 protein_coding No analysis available: incomplete transcript
ENSMUST00000152093 protein_coding No analysis available: incomplete transcript
ENSMUST00000147477 retained_intron No analysis available: incomplete transcript
ENSMUST00000123435 retained_intron No analysis available: incomplete transcript
ENSMUST00000136192 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0771_3_C03 PG00059_Z_2_H05 Stmn4tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0771_3_F02 PG00059_Z_2_H05 Stmn4tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0771_3_H02 PG00059_Z_2_H05 Stmn4tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0771_3_A04 PG00059_Z_2_H05 Stmn4tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 45883 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00059_Z_2_H05 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45883 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00059_A_H05 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
45883 Knockout First, Reporter-tagged insertion with conditional potential PCS00059_A_H05