IKMC Project Report - KOMP-CSD (ID: 23936)
Stmn4 MGI:1931224 ENSMUSG00000022044 OTTMUSG00000027814
Mice no data available
Mutagenesis Predictions
This gene has 9 wild type transcripts, of which 6 are protein-coding. Following removal of the floxed region, 6 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000074523 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MTLAAYKEKMKELPLVSLFCSCFLSDPLNKSSYKYEVPGS*
|
||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000120229 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MTLAAYKEKMKELPLVSLFCSCFLSDPLNKSSYKYEVPGS*
|
||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000121955 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MTLAAYKEKMKELPLVSLFCSCFLSDPLNKSSYKYEVPGS*
|
||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000118426 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MTLAAYKEKMKELPLVSLFCSCFLSDPLNKSSYKYEVPGS*
|
||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000134440 | protein_coding | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000152093 | protein_coding | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000147477 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000123435 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000136192 | processed_transcript | Target region does not overlap transcript | ||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | EPD0771_3_C03 | PG00059_Z_2_H05 | Stmn4tm1a(KOMP)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0771_3_F02 | PG00059_Z_2_H05 | Stmn4tm1a(KOMP)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0771_3_H02 | PG00059_Z_2_H05 | Stmn4tm1a(KOMP)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0771_3_A04 | PG00059_Z_2_H05 | Stmn4tm1a(KOMP)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 45883 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00059_Z_2_H05 | L1L2_Bact_P | L4L3_pD223_DTA_spec | view |
| order | 45883 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PRPGS00059_A_H05 | L1L2_Bact_P | L4L3_pD223_DTA_spec | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 45883 | Knockout First, Reporter-tagged insertion with conditional potential | PCS00059_A_H05 |