IKMC Project Report - KOMP-CSD (ID: 23944)

Ffar4 MGI:2147577 ENSMUSG00000054200
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000067098 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MSPECAQTTGPGPSHTLDQVNRTHFPFFSDVKGDHRLVLSVVETTVLGLIFVVSLLGNVCALVLVARRRRRGATASLVLN
LFCADLLFTSAIPLVLVVRWTEAWLLGPVVCHLLFYVMTMSGSVTILTLAAVSLERMVCIVRLRRGLSGPGRRTQAALLA
FIWGYSALAALPLCILFRVVPQRLPGGDQITKASRKRLTLSLAYSESHQIRVSQQDYRLFRTLFLLMVSFFIMWSPIIIT
ILLILIQNFRQDLVIWPSLFFWVVAFTFANSALNPILYNMSLFRNEWRKIFCCFFFPEKGAIFTDTSVRRNDLSVISS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000452038 7TM_GPCR_Rhodpsn (132/265 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000454623 7TM_GPCR_Rhodpsn (43/265 aa) CDS Deleted
ENSMUSE00000452036 7TM_GPCR_Rhodpsn (90/265 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones Without Conditional Potential (Deletions)

Note: Mutations of type "Deletion" are correctly targeted clones that have had the target exon removed. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0447_3_G10 DPGS00176_A_B08 Ffar4tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype 0.5 - 0.41 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0447_3_A09 DPGS00176_A_B08 Ffar4tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.2 - 0.11 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0447_3_B11 DPGS00176_A_B08 Ffar4tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.3 - 0.21 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0447_3_C10 DPGS00176_A_B08 Ffar4tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity fail
Distribution Centre
Karyotype 0.2 - 0.11 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 236232 Deletion (Promotor Driven Cassette) PG00176_Z_8_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236232 Deletion (Promotor Driven Cassette) PG00176_Z_1_B08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236232 Deletion (Promotor Driven Cassette) PG00176_Z_8_B08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236232 Deletion (Promotor Driven Cassette) PG00176_Z_6_B08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236232 Deletion (Promotor Driven Cassette) PG00176_Z_7_B08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236232 Deletion (Promotor Driven Cassette) PG00176_Z_3_B08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236232 Deletion (Promotor Driven Cassette) DPGS00176_A_B08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236232 Deletion (Promotor Driven Cassette) PG00176_Z_4_B08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236232 Deletion (Promotor Driven Cassette) PG00176_Z_5_B08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236232 Deletion (Promotor Driven Cassette) PG00176_Z_2_B08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
236232 Deletion PCS00176_A_B08