IKMC Project Report - KOMP-CSD (ID: 24037)

Irf7 MGI:1859212 ENSMUSG00000025498 OTTMUSG00000024538
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Irf7tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) EPD0376_1_C05 C57BL/6NTac;C57BL/6NTac;C57BL/6N-Atm1Brd/a view
( about ) 		WTSI/UCD
Southern Blot na TV Backbone Assay pass 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR pass Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation na 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 11 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000026571 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAEVSWSHGYARHTWRACSVRVCPPWTAAVSACACLAPTVSTKTSNTSSWTWVSGLDSESQLPINSSKSV

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000795302 UTR UTR
ENSMUSE00001057499 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000994617 Interferon_reg_fact_DNA-bd_dom (50/118 aa) CDS Deleted
ENSMUSE00001021105 Interferon_reg_fact_DNA-bd_dom (68/118 aa) CDS Deleted
ENSMUSE00001012236 CDS Deleted
ENSMUSE00001014185 CDS Deleted
ENSMUSE00001068534 CDS Deleted
ENSMUSE00001008725 Interferon_reg_factor-3 (125/178 aa) CDS Deleted
ENSMUSE00001032874 Interferon_reg_factor-3 (40/178 aa) CDS Deleted
ENSMUSE00000722971 Interferon_reg_factor-3 (14/178 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000097952 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAEVSWSHGYARHTWRACSVRVCPPWTAAVSACACLAPTVSTKTSNTSSWTWVSGLDSESQLPINSSKSV

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000232674 UTR UTR
ENSMUSE00001057499 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000994617 Interferon_reg_fact_DNA-bd_dom (50/118 aa) CDS Deleted
ENSMUSE00001021105 Interferon_reg_fact_DNA-bd_dom (68/118 aa) CDS Deleted
ENSMUSE00001012236 CDS Deleted
ENSMUSE00001014185 CDS Deleted
ENSMUSE00001008725 Interferon_reg_factor-3 (125/178 aa) CDS Deleted
ENSMUSE00001032874 Interferon_reg_factor-3 (40/178 aa) CDS Deleted
ENSMUSE00000232613 Interferon_reg_factor-3 (14/178 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000106023 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAEVSWSHGYARHTWRACSVRVCPPWTAAVSACACLAPTVSTKTSNTSSWTWVSGLDSESQLPINSSKSVEPWVRSAPCC
IVSLVDLVESLERR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000668300 UTR UTR
ENSMUSE00001057499 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000994617 Interferon_reg_fact_DNA-bd_dom (50/118 aa) CDS Deleted
ENSMUSE00001021105 Interferon_reg_fact_DNA-bd_dom (68/118 aa) CDS Deleted
ENSMUSE00001012236 CDS Deleted
ENSMUSE00001094851 CDS Deleted
ENSMUSE00001068534 CDS Deleted
ENSMUSE00001008725 Interferon_reg_factor-3 (125/178 aa) CDS Deleted
ENSMUSE00001032874 Interferon_reg_factor-3 (40/178 aa) CDS Deleted
ENSMUSE00000631783 Interferon_reg_factor-3 (14/178 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000123525 protein_coding No analysis available: incomplete transcript
ENSMUST00000155744 retained_intron No analysis available: incomplete transcript
ENSMUST00000131399 processed_transcript No analysis available: incomplete transcript
ENSMUST00000156938 retained_intron No analysis available: incomplete transcript
ENSMUST00000127223 retained_intron No analysis available: incomplete transcript
ENSMUST00000127161 retained_intron No analysis available: incomplete transcript
ENSMUST00000148414 retained_intron No analysis available: incomplete transcript
ENSMUST00000146373 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones Without Conditional Potential (Deletions)

Note: Mutations of type "Deletion" are correctly targeted clones that have had the target exon removed. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0376_1_C05 DPGS00163_A_H06 Irf7tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view yes view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0376_1_C06 DPGS00163_A_H06 Irf7tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0376_1_D05 DPGS00163_A_H06 Irf7tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0376_1_D06 DPGS00163_A_H06 Irf7tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0376_1_E05 DPGS00163_A_H06 Irf7tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0376_1_E06 DPGS00163_A_H06 Irf7tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0376_1_F05 DPGS00163_A_H06 Irf7tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0376_1_F06 DPGS00163_A_H06 Irf7tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0376_1_H05 DPGS00163_A_H06 Irf7tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0376_1_H06 DPGS00163_A_H06 Irf7tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 221103 Deletion (Promotor Driven Cassette) PG00163_Z_7_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221103 Deletion (Promotor Driven Cassette) PG00163_Z_2_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221103 Deletion (Promotor Driven Cassette) PG00163_Z_5_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221103 Deletion (Promotor Driven Cassette) DPGS00163_A_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221103 Deletion (Promotor Driven Cassette) PG00163_Z_3_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221103 Deletion (Promotor Driven Cassette) PG00163_Z_8_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221103 Deletion (Promotor Driven Cassette) PG00163_Z_4_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221103 Deletion (Promotor Driven Cassette) PG00163_Z_6_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221103 Deletion (Promotor Driven Cassette) PG00163_Z_1_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
221103 Deletion PCS00163_A_H06